DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and Kr-h1

DIOPT Version :10

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:397 Identity:96/397 - (24%)
Similarity:156/397 - (39%) Gaps:84/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LQLNDRMDFIFDPEPQDKNTDELASIKTTTTTEYMNAYQSV--ASPQSSPELSTDSQLSNEHFDM 173
            |||.|:    ...|.|...:.:|| |:.....:....::|:  |:|.::|   :..::..|  .:
  Fly   117 LQLQDQ----HQQEQQQFVSYQLA-IQQHQKQQQQQQHESITNAAPTAAP---SAQRIKTE--PV 171

  Fly   174 GLSPESEPESEAIDNRDTSSS---HTCSKCGLEF----ENVDELKLHK----------------- 214
            |..|.|......:  |..|:|   ..|.:||:.|    .:....|.|.                 
  Fly   172 GGFPASAAVVSQV--RKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAA 234

  Fly   215 ------YHLHD------IP--PDTK-----------FVCDHCDEGFRSAAALTRHCNMINLPLTH 254
                  ..|:|      ||  |..|           :.|:.|.:.|...|.|.||..      ||
  Fly   235 PVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYR------TH 293

  Fly   255 S------CTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHK 313
            :      |..|...|.....|:.|::  :......:.|.:||:....:..|..|:..|.|.|.||
  Fly   294 TGERPFECEFCHKLFSVKENLQVHRR--IHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHK 356

  Fly   314 CDQCSASFYTAAELCSHQKTHTTERPYIC-RYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCP 377
            |..|..:|..:.:|..|.:|||.|:||.| ...|||.|.......:|.|.|  ..::.|.|:.|.
  Fly   357 CSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTH--TGEKPYHCDICF 419

  Fly   378 KSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKT----LEARAKAAASPNS 438
            :.:......:.|:..|..::.:.|.||..:||..|...:|:|.:|::.    .||.|.:||:..|
  Fly   420 RDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGHANEVPDDEAEAAAASAAASTS 484

  Fly   439 RGRNCST 445
            .|.:..:
  Fly   485 AGSSAGS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:462262
C2H2 Zn finger 228..254 CDD:275368 7/25 (28%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..363 CDD:275368 7/21 (33%)
C2H2 Zn finger 373..393 CDD:275368 3/19 (16%)
zf-met 401..423 CDD:463736 8/21 (38%)
C2H2 Zn finger 401..419 CDD:275368 7/17 (41%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 5/19 (26%)
COG5048 <270..420 CDD:227381 46/159 (29%)
C2H2 Zn finger 273..293 CDD:275368 7/25 (28%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 385..407 CDD:275368 7/21 (33%)
C2H2 Zn finger 415..435 CDD:275368 3/19 (16%)
zf-C2H2 441..463 CDD:395048 8/21 (38%)
C2H2 Zn finger 443..463 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.