DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and CG11695

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:492 Identity:117/492 - (23%)
Similarity:191/492 - (38%) Gaps:89/492 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICRTCSRMADPAVAKNLFD-------PSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIA 61
            |||.|...|:.:|.  :||       |..|::...||....|.|..:..:.:.:|..|...|   
  Fly     2 ICRLCLDDAEHSVP--IFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQL--- 61

  Fly    62 IDFRRVCIEAQE----LLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFD 122
            .||.:.|....:    |.:|::....::|:|  ....|.|  |..|: ::||....|:..:.|  
  Fly    62 ADFEQFCAMVMKKQLGLQQLKMEPFSEDEDA--DTKAQIL--CEPEI-DVSPAAADNEECNEI-- 119

  Fly   123 PEPQDKNTDELASIKTTTTTEY---------MNAYQSVASPQS---SPELSTDSQLSNEHFDMGL 175
             :....:....:||:||:..|.         |...::|.:|::   ..:..|.:..:....|...
  Fly   120 -DGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDA 183

  Fly   176 SPESEPESEAIDNRDTSS---SH---TCSKCG--LEFENVDELKLH-KYHLHDIPPDTKFVCDHC 231
            ..|.:|||.:.::|:..|   .|   .|..||  .:|.|..|:|.| :.|...:   ...||  |
  Fly   184 EGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSL---GYVVC--C 243

  Fly   232 DEGFRSAAALTRHCNMINLPLTHSCTKCKSQFHNHILLETHKQRCLRPPAS--QHVCHICGKHLT 294
            ...::..|....|.:|.|.|....|..|..|..:.|..:.|..| ..|...  ...|..|.|..:
  Fly   244 QRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLR-FHPNKDDLSFACDQCSKRFS 307

  Fly   295 TAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSH-QKTHTTE-RPYICRYNCGKTFRFCSARS 357
            ..|.|..|...|...|..:|..|..||.||.:|..| ::||... .|:||. :||..|:......
  Fly   308 KQFLLTIHSRVHQQERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICD-SCGAKFKTKQNLL 371

  Fly   358 MHER--------------------------------VHMD-ASKRIYQCEYCPKSYVTPSECRTH 389
            :|:|                                :|:| ||.|.::||.|.....:.::...|
  Fly   372 VHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAH 436

  Fly   390 QKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTL 426
            .:||:....|.|..|...||:::....|..::..:.|
  Fly   437 IRYHHPKEYHKCTHCAKEFKSSRSLEEHTATHTGQDL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 21/82 (26%)
C2H2 Zn finger 228..254 CDD:275368 7/25 (28%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 8/20 (40%)
C2H2 Zn finger 342..363 CDD:275368 6/52 (12%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 5/17 (29%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 21/83 (25%)
C2H2 Zn finger 268..289 CDD:275368 6/21 (29%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..348 CDD:275368 8/20 (40%)
C2H2 Zn finger 357..376 CDD:275368 5/19 (26%)
C2H2 Zn finger 389..409 CDD:275368 0/19 (0%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
C2H2 Zn finger 448..468 CDD:275368 5/19 (26%)
C2H2 Zn finger 476..494 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.