DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and CG2202

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster


Alignment Length:418 Identity:104/418 - (24%)
Similarity:175/418 - (41%) Gaps:69/418 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CIEAQEL---LELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDKN 129
            |:||:|:   ::|:|.:..:..|..|:.||..:|     .:..:..:.:.| ..|....|.|...
  Fly   323 CLEAEEVDLAMQLKLEKKRRRREKAEAQAETSID-----RTVKNEHIAIGD-SQFSIKEENQLVG 381

  Fly   130 TDELASIKTTTTTEYMNAYQSVASPQSSPE-----LSTDSQL-----SNEHFDMGLSPESE--PE 182
            :|:.|.:   ...::|..:.|...|.|..|     ...||.|     .::..|.|...:.|  .:
  Fly   382 SDDEAPM---GVEDFMKLHVSGELPLSDEERFDGFADDDSDLDDDDDDDDEEDAGDDDDGEFRLK 443

  Fly   183 SEAID-----------------NRD-TSSSHTCSKCGLEFENVDELKLHKY-HLHDIPPDTKFVC 228
            .|.:|                 |:| .:..:.|..|...|.....|..||. ||...|.:    |
  Fly   444 QEPLDGEKPLKKAKSGRRRRRRNKDEPNPDNRCEVCQRTFSRHCHLLRHKLSHLEKKPHN----C 504

  Fly   229 DHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQFHNHILLETHK-----QRCLRPPA------S 282
            .||.:.|..:..|..|...::....|.|:.|::.|.....||.||     ...|.|.:      :
  Fly   505 PHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLDALERHKVSKHNGEGLEPGSELKLQLA 569

  Fly   283 QHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCG 347
            :|.|..|.|..::...|:.|.:.|... .:.|..|..:|...|:|..|:||||.:|.::|.. ||
  Fly   570 EHTCEYCSKRFSSKTYLRKHTLLHTDF-LYACKTCDETFRERAQLREHEKTHTGQRNFLCCI-CG 632

  Fly   348 KTFRFCSARSMHERVHM--DASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKT 410
            .:|    ||:.:.||||  ...::.|:|.:|.|::...::.:.|::||..|:.:.|..|..||..
  Fly   633 DSF----ARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLCNTCGKSFHR 693

  Fly   411 AKHYRSHLKSNAHKTLEARAKAAASPNS 438
            |.:...|::::   |.|...|....|.|
  Fly   694 AYNLTIHMRTH---TGERPYKCDQCPKS 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 4/10 (40%)
C2H2 Zn finger 228..254 CDD:275368 6/25 (24%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..363 CDD:275368 7/20 (35%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 6/17 (35%)
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 76/289 (26%)
C2H2 Zn finger 476..496 CDD:275368 6/19 (32%)
zf-H2C2_2 488..513 CDD:290200 10/28 (36%)
C2H2 Zn finger 504..525 CDD:275368 6/20 (30%)
C2H2 Zn finger 532..548 CDD:275368 5/15 (33%)
C2H2 Zn finger 573..593 CDD:275368 5/19 (26%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 613..637 CDD:290200 11/28 (39%)
C2H2 Zn finger 628..648 CDD:275368 10/24 (42%)
zf-H2C2_2 640..663 CDD:290200 8/22 (36%)
C2H2 Zn finger 656..676 CDD:275368 4/19 (21%)
C2H2 Zn finger 684..704 CDD:275368 6/19 (32%)
zf-C2H2 684..704 CDD:278523 6/19 (32%)
zf-H2C2_2 696..721 CDD:290200 6/26 (23%)
C2H2 Zn finger 712..732 CDD:275368 2/7 (29%)
C2H2 Zn finger 739..755 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.