DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and Zfp707

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001129369.1 Gene:Zfp707 / 315088 RGDID:1311188 Length:390 Species:Rattus norvegicus


Alignment Length:363 Identity:93/363 - (25%)
Similarity:141/363 - (38%) Gaps:42/363 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QIAIDFRRV----CIEAQELLELQLRQVEKEE--EAFESLAEQWLDDCPDELSNLSPVLQLNDRM 117
            |:.:.||.|    |.|..|.|....|.:.::.  |.|.:|.|  |..|..:.|.:|.:.|.::..
  Rat    37 QVPVTFREVAVYFCREEWECLSFSQRTLYRDVMLENFRNLNE--LGCCGRKPSLISRLEQWDEPW 99

  Fly   118 DFIFDPEPQDKNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNE-HFDMGLSPES-E 180
            ...:|....::........:..:..|..:   |....:|...|..:...|.: ||....|... :
  Rat   100 VDKWDSSELERQKSVCPGGRKASAPEKTH---SRTGAKSRTTLRKNVLTSGKAHFTRATSGRKLD 161

  Fly   181 PESEAIDNRDTSSSH-------------------TCSKCGLEFENVDELKLHKYHLHDIPPDTK- 225
            .:|||:.|:....|.                   .|..||........|..|:    .:...|: 
  Rat   162 NKSEALQNQTCGKSRRRQPGLKEQGKSAAEGHPFICGICGKALSCHSRLAAHQ----TVHTGTRS 222

  Fly   226 FVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICG 290
            |.|..|.:.||..:.|.||...........|..|...|.....|..|::  :......:||..||
  Rat   223 FECFECGQTFRWVSNLLRHQRNHTSEKPFCCEVCGQAFSLKDRLAQHQK--IHTEHRPYVCSDCG 285

  Fly   291 KHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSA 355
            |......||..|.:.|.|.|...||.|..:|.|...|..||:.|:.|:||.|. .|||.||:...
  Rat   286 KAFKQKSNLLRHKLVHTGERPFYCDNCGKTFRTKENLNHHQRIHSGEKPYTCG-ECGKAFRWPKG 349

  Fly   356 RSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKYH 393
            .|:|:|:|:  :|:.|:||.|.|.:........||:.|
  Rat   350 FSIHQRLHL--TKKFYECEECGKGFRHLGFFTRHQRTH 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 7/20 (35%)
C2H2 Zn finger 228..254 CDD:275368 7/25 (28%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
C2H2 Zn finger 342..363 CDD:275368 9/20 (45%)
C2H2 Zn finger 373..393 CDD:275368 6/19 (32%)
C2H2 Zn finger 401..419 CDD:275368
Zfp707NP_001129369.1 KRAB 40..100 CDD:214630 17/61 (28%)
KRAB 40..76 CDD:279668 10/35 (29%)
C2H2 Zn finger 197..217 CDD:275368 5/23 (22%)
C2H2 Zn finger 225..245 CDD:275368 7/19 (37%)
zf-H2C2_2 237..261 CDD:290200 5/23 (22%)
COG5048 <249..385 CDD:227381 46/140 (33%)
C2H2 Zn finger 253..273 CDD:275368 5/21 (24%)
zf-H2C2_2 266..290 CDD:290200 7/25 (28%)
zf-C2H2 279..301 CDD:278523 8/21 (38%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 293..318 CDD:290200 10/24 (42%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
zf-H2C2_2 321..344 CDD:290200 11/23 (48%)
C2H2 Zn finger 337..357 CDD:275368 9/20 (45%)
C2H2 Zn finger 365..385 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.