DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and Zfp438

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_017456046.1 Gene:Zfp438 / 307024 RGDID:1307214 Length:800 Species:Rattus norvegicus


Alignment Length:555 Identity:97/555 - (17%)
Similarity:163/555 - (29%) Gaps:244/555 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PDELSNLSPVLQLN----------DRMDFIFDPEPQDKNT---------DELASIKTTTTTEY-- 144
            |.:|.:|||..|.:          .||..: :|.|.:.||         .:|:.::|.:..:.  
  Rat   151 PAQLCHLSPSPQAHPELLHKPSPWKRMPTL-NPSPTNINTATVTSAIGQGDLSPLETDSCGDLEP 214

  Fly   145 --MNAYQSV-ASPQSSP-----------ELSTDSQLSNEHFDMGLSP------------------ 177
              :.||.:. :||||.|           |..|...:::|.....::|                  
  Rat   215 PAIPAYSTENSSPQSLPASMQKAGCARKETPTKPAVASEELQEQVAPAHSVVSSTVQSVSVVTKD 279

  Fly   178 ----------------ESEPESEAIDNRDTSSSHTCSKCGLE------FENVDELKLHKYHLHDI 220
                            :.||::|   |.::|||...:.|...      |:...|:......||  
  Rat   280 KLPILPSSRVKTTEVVKVEPDAE---NAESSSSGCRANCEERLSITEGFDAATEIANKTPALH-- 339

  Fly   221 PPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKC--------KSQFHNHIL-LETHKQRC 276
                         |.:.:|..:..|.:..|.|.......        |.:..:.|| |:..::||
  Rat   340 -------------GSKQSACKSAFCPVTKLDLNRKAKPSSGVKRRGRKWKVPDDILALQGKRRRC 391

  Fly   277 LRPPASQHVCHICGKHLTTAFN------------------------------------------- 298
                    :..:||..:..|.|                                           
  Rat   392 --------IIGMCGDSIERARNNPPEPRDQKPRATSRKYRSIMPKPVIVLSALAPLASPAAMLSQ 448

  Fly   299 ---------LKNHL--------------------VRH--AGTRR--HKCDQCSASFYTAAELCSH 330
                     |.|.|                    :|:  :|.::  |.|..|:..|.....|..|
  Rat   449 APSGLGQDVLNNALPPKCLSSKQSDNLAPKPSSALRNGFSGIKKPWHMCPVCNYHFQFKHHLLDH 513

  Fly   331 QKTHTTERPYICRYNCGKTFRFCSARSMHERVHM--DASKRIYQCEYCPKSY------------- 380
            ..|||..|||.|.. |.||:....:.|.|.::|.  :..|::..||:|.|.:             
  Rat   514 MNTHTNRRPYSCGI-CRKTYVRPGSLSAHMKLHHGDNRPKKLVCCEFCAKVFGHVRVYFGHLKEV 577

  Fly   381 --------VTPSECRTHQKYHNLTRDHG---------------------------------CEIC 404
                    .||||.::.....|..||..                                 |..|
  Rat   578 HRVVISTEPTPSELQSEDTPKNKDRDPSMQGPDSSLERETKSSLEEDFLLNQADEVKLQIRCGRC 642

  Fly   405 RISFKTAKHYRSHLKSNAHKTLEARAKAAASPNSR 439
            :|:.::....:.||.....:.::.|.:....|.||
  Rat   643 QITAQSFAEIKFHLLHVHGEEIQGRLQEVGQPGSR 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 5/25 (20%)
C2H2 Zn finger 286..306 CDD:275368 7/91 (8%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..393 CDD:275368 8/40 (20%)
C2H2 Zn finger 401..419 CDD:275368 4/17 (24%)
Zfp438XP_017456046.1 C2H2 Zn finger 497..517 CDD:275368 5/19 (26%)
zf-H2C2_2 509..534 CDD:290200 12/25 (48%)
C2H2 Zn finger 525..545 CDD:275368 6/20 (30%)
C2H2 Zn finger 557..575 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.