DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and ZNF707

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001094068.1 Gene:ZNF707 / 286075 HGNCID:27815 Length:371 Species:Homo sapiens


Alignment Length:401 Identity:95/401 - (23%)
Similarity:136/401 - (33%) Gaps:95/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QIAIDFRRVCI----EAQELLELQLRQVEKEE--EAFESLAEQWLDDCPDELSNLSPVLQLNDRM 117
            |..:.||.|.|    |....||...|.:.::.  :.|.|:|         .|...||...|..|:
Human     5 QEPVTFRDVAIYFSREEWACLEPSQRALYRDVMLDNFSSVA---------ALGFCSPRPDLVSRL 60

  Fly   118 DFIFDPEPQDKNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEH------------ 170
            :...:|..:|:...|..:::              ..|:.....|.|.:...:|            
Human    61 EQWEEPWVEDRERPEFQAVQ--------------RGPRPGARKSADPKRPCDHPAWAHKKTHVRR 111

  Fly   171 ----------------FDMGLSPESEPE------------------------SEAIDNRDTSSSH 195
                            .|.|..|.:.||                        .|....|....|.
Human   112 ERAREGSSFRKGFRLDTDDGQLPRAAPERTDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSF 176

  Fly   196 TCSKCGLEFENVDELKLHKYHLHDIPPDTK-FVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKC 259
            .|..||........|..|:    .:...|| |.|..|.:.||.|:.|.||...........|..|
Human   177 ICGTCGKALSCHSRLLAHQ----TVHTGTKAFECPECGQTFRWASNLQRHQKNHTREKPFCCEAC 237

  Fly   260 KSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTA 324
            ...|.....|..|::  :......:.|..|||......||..|.:.|.|.|...|..|..:|.|.
Human   238 GQAFSLKDRLAQHRK--VHTEHRPYSCGDCGKAFKQKSNLLRHQLVHTGERPFYCADCGKAFRTK 300

  Fly   325 AELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTH 389
            ..|..||:.|:.|:||.|. .|||:||:....|:|.|:|:  :||.|:|.:|.|.:........|
Human   301 ENLSHHQRVHSGEKPYTCA-ECGKSFRWPKGFSIHRRLHL--TKRFYECGHCGKGFRHLGFFTRH 362

  Fly   390 QKYHNLTRDHG 400
            |:.|.    ||
Human   363 QRTHR----HG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 6/20 (30%)
C2H2 Zn finger 228..254 CDD:275368 8/25 (32%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..363 CDD:275368 9/20 (45%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 95/401 (24%)
ZNF707NP_001094068.1 KRAB 8..68 CDD:214630 17/68 (25%)
KRAB 8..47 CDD:279668 11/47 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..143 10/85 (12%)
C2H2 Zn finger 178..198 CDD:275368 5/23 (22%)
COG5048 <187..366 CDD:227381 57/187 (30%)
C2H2 Zn finger 206..226 CDD:275368 8/19 (42%)
zf-H2C2_2 218..242 CDD:290200 5/23 (22%)
C2H2 Zn finger 234..254 CDD:275368 5/21 (24%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
zf-H2C2_2 274..299 CDD:290200 9/24 (38%)
C2H2 Zn finger 290..310 CDD:275368 7/19 (37%)
zf-H2C2_2 302..325 CDD:290200 11/23 (48%)
C2H2 Zn finger 318..338 CDD:275368 9/20 (45%)
C2H2 Zn finger 346..366 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.