DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and ace2

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:399 Identity:87/399 - (21%)
Similarity:131/399 - (32%) Gaps:149/399 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EEAFESL---AEQWLD--------------DCP----------DELSNL--------------SP 109
            ::||..:   |..|:|              |.|          |.|.|.              |.
pombe   148 QQAFSEIGYDASNWIDELDSQQQVLSFPEFDIPEIKTETCSNKDHLENFDYLSSSIPETSGPASS 212

  Fly   110 VL----QLNDRMDFIFDPEPQDKNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEH 170
            ||    ||....:|:|.|    .:...|..|....:.|.:|...|..||....:||:.....|  
pombe   213 VLPSSSQLESFNEFMFLP----SSPPGLDEINGAPSFEELNFQISQPSPAHPVDLSSPETAPN-- 271

  Fly   171 FDMGLSPES--------EPESE-----AIDN--------RDTSSSHTCSKCGLEFENVDELKLHK 214
                :||.|        ||.|.     |:|:        |.|.:....:|.....|.|.|.:   
pombe   272 ----ISPVSPFAQLVKLEPTSPQKPSFALDSSFSHLDVCRHTDNQKAFAKLSSPAEYVSEFE--- 329

  Fly   215 YHLHDIPPDTKF--VCDH------------CDEGFRSAA---------------------ALTRH 244
                      ||  ||||            ..:.|..:|                     .|...
pombe   330 ----------KFSSVCDHGLDISNANINNTLTQQFALSAPYESCIVTKKPEPCITVKEEEQLAPK 384

  Fly   245 CNMINLPLTHSCTKCKSQ-----FHNHILLETHKQR---CLRPPAS------------QHVC--H 287
            ....:|.:|...|:..|:     .::| ..:|.||.   |..||.:            ::||  :
pombe   385 IESADLSITPQVTEHDSKPPVRISYDH-RCKTRKQSTRICRIPPETMASLYCGPEADGKYVCLYN 448

  Fly   288 ICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRF 352
            .|.|.:...:|:::|:..|...|.::||.|.|.|....:|..|.:.|...|||:|  .|.|.|..
pombe   449 GCNKRIARKYNVESHIQTHLSDRPYRCDLCKAGFVRHHDLKRHLRIHENGRPYVC--ECLKRFNR 511

  Fly   353 CSARSMHER 361
            ..|.:.|::
pombe   512 LDALNRHKQ 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 7/58 (12%)
C2H2 Zn finger 286..306 CDD:275368 5/21 (24%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..393 CDD:275368
C2H2 Zn finger 401..419 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 86/395 (22%)
C2H2 Zn finger 448..467 CDD:275368 4/18 (22%)
zf-C2H2 473..495 CDD:278523 7/21 (33%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
zf-H2C2_2 487..511 CDD:290200 10/25 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.