DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and E4F1

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_005255212.1 Gene:E4F1 / 1877 HGNCID:3121 Length:837 Species:Homo sapiens


Alignment Length:392 Identity:87/392 - (22%)
Similarity:130/392 - (33%) Gaps:156/392 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 MGLSPESE-PESEAIDNRD-----------------------TSSS---HTCSKCGLEFENVDEL 210
            :||:.|.| .:.:.:.|:|                       |.||   |.|..||..|.....|
Human   224 LGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSL 288

  Fly   211 -KLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMI-------------------------- 248
             :.|:.|..:.|    :.|..|.:.||.:.|||||...:                          
Human   289 IRHHRRHTDERP----YKCSKCGKSFRESGALTRHLKSLTPCTEKIRFSVSKDVVVSKEDARAGS 349

  Fly   249 --------------------NLPLTHSCTKCKSQFHNHILLETHKQ--------RCL--RPPASQ 283
                                ..|:.|..|..|..    ::.|.|.|        :.|  .||.||
Human   350 GAGAAGLGTATSSVTGEPIETSPVIHLVTDAKGT----VIHEVHVQMQELSLGMKALAPEPPVSQ 410

  Fly   284 HV-CHICGKHLTTAFNLKNHLVRHAG--------------------------------------- 308
            .: |...|    :..||.:..::::|                                       
Human   411 ELPCSSEG----SRENLLHQAMQNSGIVLERAAGEEGALEPAPAAGSSPQPLAVAAPQLPVLEVQ 471

  Fly   309 -------------TRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHE 360
                         .|.|.|.|||.:|.|||.|.:|::.||..||:.|. .|||.|........|:
Human   472 PLETQVASEASAVPRTHPCPQCSETFPTAATLEAHKRGHTGPRPFACA-QCGKAFPKAYLLKKHQ 535

  Fly   361 RVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAK----HYRSHLKSN 421
            .||:  .:|.::|..|.|.|.|.:..|.|::.|:..|.:.|..|...:||..    |:|:||:..
Human   536 EVHV--RERRFRCGDCGKLYKTIAHVRGHRRVHSDERPYPCPKCGKRYKTKNAQQVHFRTHLEEK 598

  Fly   422 AH 423
            .|
Human   599 PH 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 10/71 (14%)
C2H2 Zn finger 286..306 CDD:275368 4/19 (21%)
C2H2 Zn finger 314..334 CDD:275368 10/19 (53%)
C2H2 Zn finger 342..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..393 CDD:275368 7/19 (37%)
C2H2 Zn finger 401..419 CDD:275368 7/21 (33%)
E4F1XP_005255212.1 COG5048 236..648 CDD:227381 83/380 (22%)
C2H2 Zn finger 247..267 CDD:275368 0/19 (0%)
zf-C2H2 273..295 CDD:278523 7/21 (33%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-H2C2_2 287..310 CDD:290200 6/26 (23%)
zf-C2H2 301..322 CDD:278523 9/20 (45%)
C2H2 Zn finger 303..321 CDD:275368 9/17 (53%)
C2H2 Zn finger 490..510 CDD:275368 10/19 (53%)
DUF45 <506..585 CDD:302795 27/81 (33%)
C2H2 Zn finger 518..538 CDD:275368 6/20 (30%)
C2H2 Zn finger 546..566 CDD:275368 7/19 (37%)
zf-H2C2_2 558..583 CDD:290200 6/24 (25%)
C2H2 Zn finger 574..594 CDD:275368 6/19 (32%)
zf-H2C2_2 588..609 CDD:290200 5/13 (38%)
C2H2 Zn finger 602..622 CDD:275368
zf-H2C2_2 614..638 CDD:290200
C2H2 Zn finger 630..649 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.