DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and bcl-11

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001122913.1 Gene:bcl-11 / 179019 WormBaseID:WBGene00017430 Length:694 Species:Caenorhabditis elegans


Alignment Length:370 Identity:71/370 - (19%)
Similarity:121/370 - (32%) Gaps:100/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PAVAKNLFDPSSSSVLRQIETLTNLQ-LKEDGKLPRFMCQDCQHDLQIAIDFRRVCIEAQELLEL 77
            |.:|.....||..:...|:...|:.. |......|:..........|.:.....|.::...|..:
 Worm   299 PLMALRRLMPSEETEEEQVSAFTSTSLLNSRASQPQLPTVSSSAGFQTSGSMPNVWMQPSMLAAM 363

  Fly    78 QLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDKNTDELASIKTTTTT 142
            |        |.:.|:.:.     |..::|.:.|..||...:.....:.|.:...:..::      
 Worm   364 Q--------EYYASIQQM-----PYPMTNSTAVALLNISNNLQQQQQQQQQLQQQQQNL------ 409

  Fly   143 EYMNAYQSVASPQ---SSPELSTDSQLSNEHFDMGLSPESEPESEAIDNRDTSSSH-TCSKCGLE 203
              :.|...||:||   .:|...:.::||... :...:|  .|.|.||..|.:.... |..:..::
 Worm   410 --IAAQPQVATPQPPAPTPLFQSLNRLSTAD-ESSYTP--RPASVAIRRRASPEEELTPPRKSMK 469

  Fly   204 FENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCTKCKSQFHNHIL 268
            .|..|:|.:                  .|:|..:..|..:..|:                     
 Worm   470 IEEEDQLIV------------------VDDGELAEPAARKPNNI--------------------- 495

  Fly   269 LETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKT 333
               .|:|          |:.|.|..|...||..||..|.|.:.:||..|..:...:::|..|.:|
 Worm   496 ---KKER----------CNFCNKVFTNRSNLIVHLRSHTGEKPYKCQLCPYACAQSSKLTRHMRT 547

  Fly   334 H-----TTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQC 373
            |     .|...||||              |...||....|.:.:|
 Worm   548 HGQQGKETYHCYICR--------------MPFSVHSTLEKHMRKC 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 11/62 (18%)
C2H2 Zn finger 228..254 CDD:275368 4/25 (16%)
C2H2 Zn finger 286..306 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..363 CDD:275368 3/20 (15%)
C2H2 Zn finger 373..393 CDD:275368 1/1 (100%)
C2H2 Zn finger 401..419 CDD:275368
bcl-11NP_001122913.1 zf-C2H2 499..520 CDD:278523 9/30 (30%)
zf-C2H2_2 500..>577 CDD:289522 26/90 (29%)
C2H2 Zn finger 500..520 CDD:275368 8/19 (42%)
zf-H2C2_2 512..537 CDD:290200 9/24 (38%)
C2H2 Zn finger 528..548 CDD:275368 4/19 (21%)
C2H2 Zn finger 558..576 CDD:275368 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.