DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and eor-1

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001367921.1 Gene:eor-1 / 177249 WormBaseID:WBGene00001324 Length:909 Species:Caenorhabditis elegans


Alignment Length:411 Identity:99/411 - (24%)
Similarity:153/411 - (37%) Gaps:77/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CIEAQELLELQLR----QVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEP--- 125
            ||.:...|:|.:|    :|.|.||.|..|    |:.|  |...:|.     |.::|:.|..|   
 Worm   199 CITSDTYLKLIVRWVGEEVSKREEIFRLL----LESC--EFREVSA-----DTLEFLLDYSPLLS 252

  Fly   126 -QDKNTDELASIKTTT-------TTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPE 182
             ..|:...|..:..|.       :|:..:..|.:.   ..|.|...||..::.:|...| |.:|:
 Worm   253 KSQKSRFLLLHVMETNNMLMEKYSTQLSSLRQKIV---DLPILHDPSQFEDDIYDSSDS-EEDPD 313

  Fly   183 SEAIDNRDTSSS--------HTCSKCGLEFENVDELK-------LHKYHLHDIPP-------DTK 225
            ....|...||:.        :...|..:.|:..:|.|       :.|:|||.|||       ...
 Worm   314 DYIADGHPTSAQVVEYGNDVNNRLKMKIAFQPGNEKKRLKRPKGMKKHHLHPIPPINATENESIP 378

  Fly   226 FVCDHCDEGFRSAAALTRHCNMI--------------------NLPLTHSCTKCKSQFHNHILLE 270
            ::.:...:|..:..:| ..|:..                    |.|.|  |..|..:..|..|||
 Worm   379 WIDEDEIDGVYATCSL-EGCHTYGPVDNLDPDDCEDEEDQPDENGPST--CIFCGLRTANEELLE 440

  Fly   271 THKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHT 335
            .||.| .....:.::||:|......:.....|...|.....::|:.|..:.....|..:|:..||
 Worm   441 KHKAR-HHNRNTYYMCHLCEFETNWSKQFYLHCAEHWTEIPYRCETCPFTSNEIQEFLTHRLQHT 504

  Fly   336 TERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHG 400
            .||.:.|. .|....|..|....|||:|.....|...||.|.:.:...|....|...||..|.:.
 Worm   505 DERFFKCG-ECAWKGRTRSQLFAHERMHSVLDDRSLHCEECGRGFQQHSTLDHHVASHNDPRPYI 568

  Fly   401 CEICRISFKTAKHYRSHLKSN 421
            ||.|..:.|||.|...|.:.:
 Worm   569 CEDCGFATKTADHLSLHRRQH 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 2/7 (29%)
C2H2 Zn finger 228..254 CDD:275368 5/45 (11%)
C2H2 Zn finger 286..306 CDD:275368 4/19 (21%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..363 CDD:275368 7/20 (35%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 8/17 (47%)
eor-1NP_001367921.1 PHA03098 34..>229 CDD:222983 11/33 (33%)
BTB_POZ_ZBTB_KLHL-like 41..118 CDD:349497
C2H2 Zn finger 455..475 CDD:275368 4/19 (21%)
zf-C2H2_8 <481..527 CDD:406359 12/46 (26%)
C2H2 Zn finger 483..503 CDD:275368 4/19 (21%)
C2H2 Zn finger 511..531 CDD:275368 7/20 (35%)
C2H2 Zn finger 541..561 CDD:275368 5/19 (26%)
C2H2 Zn finger 569..589 CDD:275368 8/19 (42%)
C2H2 Zn finger 601..618 CDD:275368
C2H2 Zn finger 626..646 CDD:275368
zf-H2C2_2 638..663 CDD:404364
zf-H2C2_5 652..676 CDD:404746
C2H2 Zn finger 654..674 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.