DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31388 and ZNF524

DIOPT Version :9

Sequence 1:	NP_650060.1	Gene:	CG31388 / 41355	FlyBaseID:	FBgn0051388	Length:	446	Species:	Drosophila melanogaster
Sequence 2:	XP_011524789.1	Gene:	ZNF524 / 147807	HGNCID:	28322	Length:	370	Species:	Homo sapiens

Alignment Length:	135	Identity:	43/135 - (31%)
Similarity:	65/135 - (48%)	Gaps:	12/135 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   307 AGTRR--HKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVH--MDAS 367
            :|.|:  |.|..|..:|...::|..|..:|:..:|:.|:. |||||:    ||.|.|.|  :.|.
Human   213 SGPRKAPHFCPVCLRAFPYLSDLERHSISHSELKPHQCKV-CGKTFK----RSSHLRRHCNIHAG 272

  Fly   368 KRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKA 432
            .|.::|..||:.:....|...|.:.|:..|.:.|.|||:.|..|...|.|.|   .|..||....
Human   273 LRPFRCPLCPRRFREAGELAHHHRVHSGERPYQCPICRLRFTEANTLRRHAK---RKHPEAMGVP 334

  Fly   433 AASPN 437
            ..:|:
Human   335 LCAPD 339

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31388	NP_650060.1	zf-AD	4..76	CDD:285071
		C2H2 Zn finger	228..254	CDD:275368
		C2H2 Zn finger	286..306	CDD:275368
		C2H2 Zn finger	314..334	CDD:275368	5/19 (26%)
		C2H2 Zn finger	342..363	CDD:275368	10/20 (50%)
		C2H2 Zn finger	373..393	CDD:275368	5/19 (26%)
		C2H2 Zn finger	401..419	CDD:275368	8/17 (47%)
ZNF524	XP_011524789.1	COG5048	<219..>283	CDD:227381	23/68 (34%)
		C2H2 Zn finger	222..242	CDD:275368	5/19 (26%)
		zf-H2C2_2	234..259	CDD:290200	10/29 (34%)
		C2H2 Zn finger	250..270	CDD:275368	11/24 (46%)
		zf-H2C2_2	262..285	CDD:290200	8/22 (36%)
		C2H2 Zn finger	278..298	CDD:275368	5/19 (26%)
		zf-H2C2_2	290..314	CDD:290200	8/23 (35%)
		C2H2 Zn finger	306..327	CDD:275368	9/23 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100