DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31388 and ZNF358

DIOPT Version :9

Sequence 1:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_060553.4 Gene:ZNF358 / 140467 HGNCID:16838 Length:568 Species:Homo sapiens


Alignment Length:394 Identity:111/394 - (28%)
Similarity:154/394 - (39%) Gaps:75/394 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VEKEEEAFESLAEQWLDDC---------PDELSN--------LSPVLQLNDRMDFIFDP-----E 124
            |:...|..|.::|....|.         ||.:|:        :.||       ..|.||     .
Human    57 VDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPDVIGPV-------PLILDPNSDTLS 114

  Fly   125 PQDKNTDELASIKT------TTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPES 183
            |.|...|.::|..|      .|:...:.|..|...|.|.|:.....:.|:     |||       
Human   115 PGDPKVDPISSGLTATPQVLATSPAVLPAPASPPRPFSCPDCGRAFRRSS-----GLS------- 167

  Fly   184 EAIDNRDTSSS---HTCSKCGLEFENVDELKLHK-YHLHDIPPDTKFVCDHCDEGFRSAAALTRH 244
               .:|.|.|.   :.|..||..|.:...|..|: .|....|    :.|..|.:.|...:.|.:|
Human   168 ---QHRRTHSGEKPYRCPDCGKSFSHGATLAQHRGIHTGARP----YQCAACGKAFGWRSTLLKH 225

  Fly   245 CNMINLPLTHSCTKCKSQF-HNHIL---LETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVR 305
            .:..:....|.|..|...| |..:|   |.||...  ||    |.|.:|.|.......|..||..
Human   226 RSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGP--RP----HKCPVCAKGFGQGSALLKHLRT 284

  Fly   306 HAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRI 370
            |.|.|.:.|.||..:|..::.|..||:|||.||||.|.: |||.|...|....|.|:|  ..:|.
Human   285 HTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPH-CGKAFGQSSNLQHHLRIH--TGERP 346

  Fly   371 YQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTA----KHYRSHLKSNAHKTLEARAK 431
            |.|.:|.|::...|....|...|:..|.:.|::|..:|..|    ||.|.|..:.|.....|.|.
Human   347 YACPHCSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHEGAAAAAAAAAAAA 411

  Fly   432 AAAS 435
            |||:
Human   412 AAAA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 5/25 (20%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 8/21 (38%)
ZNF358NP_060553.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117 14/66 (21%)
COG5048 <35..339 CDD:227381 86/314 (27%)
lambda-1 108..>174 CDD:212564 18/80 (23%)
zf-C2H2 151..173 CDD:278523 7/36 (19%)
C2H2 Zn finger 153..173 CDD:275368 6/34 (18%)
zf-H2C2_2 166..190 CDD:290200 9/33 (27%)
C2H2 Zn finger 181..201 CDD:275368 6/19 (32%)
zf-H2C2_2 194..216 CDD:290200 6/25 (24%)
C2H2 Zn finger 209..229 CDD:275368 5/19 (26%)
zf-H2C2_2 222..244 CDD:290200 5/21 (24%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
zf-H2C2_2 250..272 CDD:290200 10/27 (37%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-H2C2_2 277..300 CDD:290200 9/22 (41%)
zf-C2H2_8 292..370 CDD:292531 30/80 (38%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-H2C2_2 305..328 CDD:290200 14/23 (61%)
C2H2 Zn finger 321..341 CDD:275368 8/20 (40%)
zf-H2C2_2 333..356 CDD:290200 8/24 (33%)
C2H2 Zn finger 349..369 CDD:275368 5/19 (26%)
zf-H2C2_2 361..384 CDD:290200 5/22 (23%)
zf-C2H2 375..397 CDD:278523 7/21 (33%)
C2H2 Zn finger 377..397 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.