DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17721 and DEP

DIOPT Version :10

Sequence 1:NP_001247041.1 Gene:CG17721 / 41354 FlyBaseID:FBgn0037885 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_177247.1 Gene:DEP / 843430 AraportID:AT1G70910 Length:161 Species:Arabidopsis thaliana


Alignment Length:50 Identity:12/50 - (24%)
Similarity:26/50 - (52%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DLCTIC-LDPLSVYTMVYLRCSHALHEKCLHQYQANGGRHCPVCRMGIKE 149
            :.|.:| |:...::.|.  .|:|..|..|:.::.:. ..:||:|.:.|.:
plant   112 ETCGLCLLEEQHLFDMP--NCAHVFHGDCIDKWLST-SNNCPLCGVEIMD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17721NP_001247041.1 RING_Ubox 103..145 CDD:473075 11/42 (26%)
DEPNP_177247.1 RING_Ubox 114..152 CDD:473075 10/40 (25%)

Return to query results.
Submit another query.