DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arfip and arfip2

DIOPT Version :9

Sequence 1:NP_650058.1 Gene:Arfip / 41353 FlyBaseID:FBgn0037884 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_031753315.1 Gene:arfip2 / 100380075 XenbaseID:XB-GENE-997831 Length:368 Species:Xenopus tropicalis


Alignment Length:369 Identity:158/369 - (42%)
Similarity:225/369 - (60%) Gaps:54/369 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERSIHEMLKDAPSLNDSCGAVHTGTEGGSGILGSASSHSIAGGGGGGGNVGVGVGGPFGAPSSLP 69
            |:.:.:::...|:||::                     ||..||.||...|:           :|
 Frog    35 EQDLQQVMVSGPNLNET---------------------SIVSGGYGGTAEGI-----------IP 67

  Fly    70 LRNHSAPTTPMSPS----SPP------------SGNGILSPTDSGSGSIIRTSASKIDSLKNWSI 118
            ......|....:|:    .||            |.:..|:..:...|    .:..|.|.:|.|.|
 Frog    68 TGTIKGPAVQFNPNYIGVRPPHAQTQGGMSQQCSSHNALTSEELSRG----LAVEKFDLVKKWGI 128

  Fly   119 STYKCTRQIMLEKLGKSQRTVDSELEAQIEQLRETQRKYLSILRLTRAFSSHFQHVVVTQHALAD 183
            :|||||:|::.|:.|:..||||.|||.|||.||:|:|||..:|:|.||.::||..:|.||.||.|
 Frog   129 NTYKCTKQMISERFGRGTRTVDLELETQIELLRDTKRKYEGVLQLARALTAHFYSLVQTQRALGD 193

  Fly   184 SFADLAQKNPELQKEFTCNSETQRNLTKNGELLLNALNFFISSVNTLCNKTIDDTLLTIRQYETA 248
            :|:||:||:||||:||..|:|||:.|.||||.||.|:|||:||:|||.|||::|||:|::|||||
 Frog   194 AFSDLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLINKTMEDTLMTVKQYETA 258

  Fly   249 RIEFDAYRMDLENTK--PELTPSAVALEETQRSYAQHKEQYEKLRSDVAVKMQFLDENRIKVMHK 311
            |:||||||.|||...  |....:...:|..|:::..|:.:|||||.||.:|::||.||::|||.|
 Frog   259 RLEFDAYRADLEELSLGPRDAATLCRMETAQQNFQSHRVKYEKLRGDVTIKLRFLQENKVKVMRK 323

  Fly   312 QLILLHNAIAAYFSGNAMALESTLKQFNIKLKSPNAVTGSWLEQ 355
            ||:|.||||::||:||...||::|:||||||.|..:...||||:
 Frog   324 QLLLFHNAISSYFAGNQQQLEASLQQFNIKLSSRGSDKPSWLEE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfipNP_650058.1 BAR_Arfaptin 140..338 CDD:153344 112/199 (56%)
arfip2XP_031753315.1 BAR_Arfaptin 150..350 CDD:153344 112/199 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1179170at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12141
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.