DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph3 and dph3

DIOPT Version :10

Sequence 1:NP_650057.1 Gene:Dph3 / 41352 FlyBaseID:FBgn0037883 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001342897.1 Gene:dph3 / 2543434 PomBaseID:SPAC8F11.02C Length:79 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:39/72 - (54%)
Similarity:54/72 - (75%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPSCSLVIKVIYDPEMFK 65
            ||.| ||:|:|||.:|....:|.:||||||||:||.|:|..||:||.||||||:::||||.:.|.
pombe     1 MSFY-DEIELEDFTFDAGTNLYTFPCPCGDRFEISLEDLQLGEDVARCPSCSLIVRVIYDEDEFM 64

  Fly    66 AEEDEES 72
            ..:::.|
pombe    65 EVDNDAS 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph3NP_650057.1 zf-CSL <25..60 CDD:398744 24/34 (71%)
dph3NP_001342897.1 COG5216 1..67 CDD:227541 38/66 (58%)

Return to query results.
Submit another query.