DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and cbpA

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_415520.1 Gene:cbpA / 947572 ECOCYCID:EG12193 Length:306 Species:Escherichia coli


Alignment Length:187 Identity:46/187 - (24%)
Similarity:77/187 - (41%) Gaps:58/187 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPD--KNPDNPKAVERFHELSKALEILT 63
            |..|.|     |.::|:....|...|:.|||:.|.:.|||  |.||   |..||.|:::|.|:|:
E. coli     1 MELKDY-----YAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPD---AEARFKEVAEAWEVLS 57

  Fly    64 DESARAAYDKVLKAKKAAELRSRQL---DGK----------------------RQK--------- 94
            ||..||.||::.:.:...:. :||.   ||:                      ||:         
E. coli    58 DEQRRAEYDQMWQHRNDPQF-NRQFHHGDGQSFNAEDFDDIFSSIFGQHARQSRQRPATRGHDIE 121

  Fly    95 ------LKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQI-------ERLRREG 138
                  |:..|.|.:|...:.|.....:..:.:...:.|:.:|       :|:|.:|
E. coli   122 IEVAVFLEETLTEHKRTISYNLPVYNAFGMIEQEIPKTLNVKIPAGVGNGQRIRLKG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/63 (40%)
RRM_DNAJC17 175..247 CDD:240875
cbpANP_415520.1 PRK10266 1..306 CDD:182347 46/187 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
21.910

Return to query results.
Submit another query.