DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and djlB

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_415179.1 Gene:djlB / 945245 ECOCYCID:G6353 Length:475 Species:Escherichia coli


Alignment Length:333 Identity:69/333 - (20%)
Similarity:117/333 - (35%) Gaps:106/333 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHE------LSKALEILTDESAR 68
            |.:.:|.|...:|.:.||:||.......||:.:|...|.:.:.:|      .|.|..:...|...
E. coli     3 NCWKILDIEETTDVDIIRRAYLALLPSFHPETDPQGFKQLRQAYEEALRIAQSPAKSVWQPEEYE 67

  Fly    69 AAYDKVLKAKKA--AELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEE------ 125
            .|..::|.|.:|  |....|.|....|:...:|.......:.:|..|  ..|:|.:...      
E. coli    68 VAEHEILLAFRALLASDSERFLPSAWQRFIQQLNYCSMEEIDELRWS--LCTIAMNTAHLSFECV 130

  Fly   126 -VLHEQIERLRREGSRLLEEEQR-----------------------AMQ-------EQFRR---N 156
             :|.|::..|:.|.:..::||:.                       |:|       :.|.|   :
E. coli   131 VLLAERLRWLQEENTGEIDEEELESFLYAIAKGNVFNFQTILHLPVAVQNDTIDFYQMFARIWSS 195

  Fly   157 HAEQQKL---QQQPVQF--DSAQHRIKMKW-------------------KAEPGQ------DYTQ 191
            |.:...|   |.:.|..  |:..||..::|                   :.||..      :|.|
E. coli   196 HPQWLTLYLAQHRAVIIPDDAKLHRNLLRWYSAGRLDIPELLDYAQSWRETEPDNEDAPYYEYAQ 260

  Fly   192 Q-----------ELLKYLKKYGDVV--ALVVNSKRRGRA-----MVELATREACDMV------LA 232
            :           ||..|.::|....  ||::...|:.|.     :|.:.  ||.|:|      |.
E. coli   261 RVYCGEGESLLAELCDYWREYPSTQADALMLQWCRQHRVDYYPLLVMMI--EARDLVNDQGKPLL 323

  Fly   233 YEKGDPAK 240
            |..||.|:
E. coli   324 YVPGDSAR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 17/67 (25%)
RRM_DNAJC17 175..247 CDD:240875 25/115 (22%)
djlBNP_415179.1 DnaJ 2..47 CDD:197617 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.