DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and CAJ1

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_010967.3 Gene:CAJ1 / 856772 SGDID:S000000850 Length:391 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:68/268 - (25%)
Similarity:116/268 - (43%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72
            :...||:|||..|:...||:||||:||:|.||||:||:|.|..:|..:.:|.::|:|...|:.||
Yeast     4 ETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRSKYD 68

  Fly    73 KVLKA--------KKAAELRSRQLDGKRQK-------LKLELEERERAALHKLAKSQPYSTVA-- 120
            :..|.        :.|:|..:....|...|       |..||.|    |.....|.....|.|  
Yeast    69 QFGKEDAVPQQGFEDASEYFTAIFGGDGFKDWIGEFSLFKELNE----ATEMFGKEDEEGTAATE 129

  Fly   121 --KSDEE-----VLHE--QIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHR 176
              |:||.     |.|:  :.|.|:::  :|.:|::..:.|..::...:..|      |.|....:
Yeast   130 TEKADESTDGGMVKHDTNKAESLKKD--KLSKEQREKLMEMEKKRREDMMK------QVDELAEK 186

  Fly   177 IKMK-------WKAEPGQDYTQQ---------------ELLKYLKKYGDVVA--LVVNSKRRGRA 217
            :..|       .|:...:::|::               |||..|.:.....|  .:::.|..|.:
Yeast   187 LNEKISRYLIAVKSNNLEEFTRKLDQEIEDLKLESFGLELLYLLARVYKTKANNFIMSKKTYGIS 251

  Fly   218 MVELATRE 225
            .:...||:
Yeast   252 KIFTGTRD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 28/61 (46%)
RRM_DNAJC17 175..247 CDD:240875 12/75 (16%)
CAJ1NP_010967.3 DnaJ 2..>98 CDD:223560 34/93 (37%)
DnaJ-X 176..376 CDD:405064 15/90 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46959
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.