DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and DJP1

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_012269.1 Gene:DJP1 / 854820 SGDID:S000001443 Length:432 Species:Saccharomyces cerevisiae


Alignment Length:361 Identity:85/361 - (23%)
Similarity:147/361 - (40%) Gaps:87/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72
            |...|||||:|..:...||:||||||:::.||||||::|.|.|||..:|:|.::|.|:..||.||
Yeast     4 DTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRAKYD 68

  Fly    73 K------------------------------------VLKAKKAAELRSRQLDGKRQKLKLELEE 101
            |                                    :||..:..|..:.:.:.:::|..:|..|
Yeast    69 KYGRKEAIPQGGFEDAAEQFSVIFGGDAFASYIGELMLLKNLQKTEELNAEDEAEKEKENVETME 133

  Fly   102 RE-------------RAAL----HKLAKSQPYST---VAKSDEEVLHEQI-ERLRREGSRL--LE 143
            ..             .|||    .|..|::..:|   :...|....:||: ...:::.::|  .|
Yeast   134 ESPADGKTNGTTNAVDAALGNTNEKDDKNKARTTSGNLTVHDGNKKNEQVGAEAKKKKTKLEQFE 198

  Fly   144 EEQRAMQ----EQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQELLKYLKKYGDV 204
            |||...:    :|..:...|:..:..:.|..|:.:...|.|::.|       ..||| ::.:|..
Yeast   199 EEQEVEKQKRVDQLSKTLIERLSILTESVYDDACKDSFKKKFEEE-------ANLLK-MESFGLD 255

  Fly   205 VALVVNSKRRGRAMVELATREACDMVLAYE----KG----DPAKPLHFEWVTPPAADKQTTKSAT 261
            :...:......:|.:.||::....|...:.    ||    |..:      ....|.|.|.|....
Yeast   256 ILHTIGDVYYEKAEIFLASQNLFGMGGIFHSMKAKGGVFMDTLR------TVSAAIDAQNTMKEL 314

  Fly   262 TGCSASSTDYEDLVMRKLRQAEERKRLIEQMMKDEE 297
            .....:||:.|.|..:.  ..|:.|...|::.:.|:
Yeast   315 EKMKEASTNNEPLFDKD--GNEQIKPTTEELAQQEQ 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 31/61 (51%)
RRM_DNAJC17 175..247 CDD:240875 14/79 (18%)
DJP1NP_012269.1 PRK10767 7..>97 CDD:236757 34/89 (38%)
DnaJ-X 208..422 CDD:405064 30/157 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I2122
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46959
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.