DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and CWC23

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_011387.2 Gene:CWC23 / 852749 SGDID:S000003096 Length:283 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:64/242 - (26%)
Similarity:102/242 - (42%) Gaps:52/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNLYDLLGI-------SLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDES 66
            :||||:|.:       ::..|..:|::.||..||:.||||:||||..:.:||.||.|..|||:..
Yeast    14 LNLYDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIHKFHLLSTATNILTNAD 78

  Fly    67 ARAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQI 131
            .|..||:.|     .|...:..|.:|.||..:|||.|.:.:       |.:|.        |..:
Yeast    79 VRPHYDRWL-----IEFLRKTNDIERNKLIQKLEESESSTI-------PTTTP--------HPDL 123

  Fly   132 ERLRREGS--RLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQEL 194
            .:::|.|.  |.|:.......:....|..:|:...|.| .:|.:..||.:.              
Yeast   124 LQIQRHGELLRKLKHFNLPYGDWKHLNTQDQENASQHP-YYDCSTLRIVLD-------------- 173

  Fly   195 LKYLKKYGDVVALVVNSKRRGRAMVELATREACDMVLA----YEKGD 237
             .:|:.......|   |..|.:..:.|:..|..|:..:    |.|.|
Yeast   174 -NFLQSNNKSNCL---SHLRNQVFITLSANEIYDIYFSERNNYSKDD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 28/68 (41%)
RRM_DNAJC17 175..247 CDD:240875 12/67 (18%)
CWC23NP_011387.2 CbpA 14..228 CDD:225124 64/242 (26%)
DnaJ 15..84 CDD:395170 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R269
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.