powered by:
Protein Alignment CG17187 and PAM18
DIOPT Version :9
Sequence 1: | NP_650056.1 |
Gene: | CG17187 / 41351 |
FlyBaseID: | FBgn0037882 |
Length: | 299 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013108.1 |
Gene: | PAM18 / 850694 |
SGDID: | S000003998 |
Length: | 168 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 38 |
Identity: | 11/38 - (28%) |
Similarity: | 20/38 - (52%) |
Gaps: | 1/38 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 QNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALE 60
:.::::.:||..|..||||. .:|....:.:|....||
Yeast 126 KKKLKEVHRKIMLANHPDKG-GSPFLATKINEAKDFLE 162
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17187 | NP_650056.1 |
DnaJ |
10..72 |
CDD:278647 |
11/38 (29%) |
RRM_DNAJC17 |
175..247 |
CDD:240875 |
|
PAM18 | NP_013108.1 |
DnaJ |
<103..163 |
CDD:413365 |
11/38 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.