DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and PAM18

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_013108.1 Gene:PAM18 / 850694 SGDID:S000003998 Length:168 Species:Saccharomyces cerevisiae


Alignment Length:38 Identity:11/38 - (28%)
Similarity:20/38 - (52%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALE 60
            :.::::.:||..|..||||. .:|....:.:|....||
Yeast   126 KKKLKEVHRKIMLANHPDKG-GSPFLATKINEAKDFLE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 11/38 (29%)
RRM_DNAJC17 175..247 CDD:240875
PAM18NP_013108.1 DnaJ <103..163 CDD:413365 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.