DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and ATERDJ2A

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001031306.2 Gene:ATERDJ2A / 844334 AraportID:AT1G79940 Length:687 Species:Arabidopsis thaliana


Alignment Length:365 Identity:77/365 - (21%)
Similarity:142/365 - (38%) Gaps:118/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHE-LSKALEILTDESARAAYDKVL 75
            :.:||:......:||:||||:.:::.||||||| |:|.:.|.| :|||.:.|||..:|..::|. 
plant   101 FSILGLEPGVTDSEIKKAYRRLSIQYHPDKNPD-PEANKYFVEFISKAYQALTDSVSRENFEKY- 163

  Fly    76 KAKKAAELRSRQLDGKR--------QKLKLELEERERA-----------------ALHKLAKSQP 115
                      ...||::        .:..|:::.....                 |:..|::|..
plant   164 ----------GHPDGRQGFQMGIALPQFLLDIDGASGGILLLWIVGVCILLPLVIAVIYLSRSSK 218

  Fly   116 YSTVAKSDEEVLHEQIER---LRREG---SRLLEEEQRA---MQEQFRRNHAEQ-QKLQQQPVQF 170
            |     :...|:|:.:..   |.:..   |:::|...:|   |:...||...|. |||      |
plant   219 Y-----TGNYVMHQTLSAYYYLMKPSLAPSKVMEVFTKAAEYMEIPVRRTDDEPLQKL------F 272

  Fly   171 DSAQHRIKMKWKAEPGQDYTQQELLKYLKKYGDVVAL-------------VVNSKRRG--RAMVE 220
            .|.:..:.:..|      ..:||..|:.|::..:|..             |::...:|  |.::|
plant   273 MSVRSELNLDLK------NMKQEQAKFWKQHPAIVKTELLIQAQLTRESGVLSPALQGDFRRVLE 331

  Fly   221 LATR---EACDMVLAYEKGDPAKPLHFEWVTP---------------PAADKQTTKSATTGCS-- 265
            ||.|   |...|.:.     |.......|:.|               |.:.::::..::.|.|  
plant   332 LAPRLLEELLKMAVI-----PRTAQGHGWLRPAVGVVELSQCIVQAVPLSARKSSGVSSEGISPF 391

  Fly   266 ASSTDYEDLVMRKL-------------RQAEERKRLIEQM 292
            .....:.|.|::|:             .:.|:|..|:.|:
plant   392 LQLPHFSDAVVKKIARKKVKSFQDLQEMRLEDRSELLTQV 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 26/60 (43%)
RRM_DNAJC17 175..247 CDD:240875 16/89 (18%)
ATERDJ2ANP_001031306.2 DnaJ 99..161 CDD:395170 26/60 (43%)
SEC63 207..605 CDD:214744 47/247 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.