DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AT1G77020

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_177828.2 Gene:AT1G77020 / 844038 AraportID:AT1G77020 Length:379 Species:Arabidopsis thaliana


Alignment Length:306 Identity:77/306 - (25%)
Similarity:127/306 - (41%) Gaps:44/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            ||:||::..:.:.||||||..||.:.|||||..:|.|.|:|..|.:|.::|:|...|.|||:..|
plant     8 YDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSDPVHREAYDRTGK 72

  Fly    77 AKKAAELRSRQLDGKRQKLKL---ELEER--ERAALHKLAKSQPYSTVAKSDE------EVLHEQ 130
            .....|   ..:|.......|   ||.|.  ...|:..:|.:|..|.:..||:      .|..|:
plant    73 FSAPKE---TMVDPTAVFALLFGSELFEDYIGHLAVASMASTQMASEIENSDQFQDKLKAVQKER 134

  Fly   131 IERLRREGSRLLEEEQRAMQEQF-RRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQEL 194
            .|.|.|.....|.:.....:|.| .|..:|.::|.......|.. |.|...:..:..|:..::.|
plant   135 EENLSRFLKDFLSQYVHGDKEGFISRAESEAKRLSDAAFGADML-HTIGYVYTRQAAQELGKRAL 198

  Fly   195 -------LKYLKKYGDVVALVVNSKRRGRAMVELATREACDMVLAYEKGDPAKPLHFEWVTPPAA 252
                   .::::..|......:::.:....:::|  :|..:..|..:...||..|.        :
plant   199 YLGVPFVAEWVRNKGHSWKSQISAAKGALQLLQL--QEESNRRLKKDGTSPANELE--------S 253

  Fly   253 DKQTTKSATTGC--SASSTDYE-------DLVMRK--LRQAEERKR 287
            ..||.|....|.  ..:..|.|       .:|.|:  ||:.|.:.|
plant   254 HIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVFRENNLRKEELKSR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 27/59 (46%)
RRM_DNAJC17 175..247 CDD:240875 11/78 (14%)
AT1G77020NP_177828.2 DnaJ 7..>72 CDD:223560 29/63 (46%)
DnaJ 7..68 CDD:278647 27/59 (46%)
DnaJ-X 131..318 CDD:291006 34/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.