DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AT1G76700

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_177796.1 Gene:AT1G76700 / 844003 AraportID:AT1G76700 Length:398 Species:Arabidopsis thaliana


Alignment Length:321 Identity:70/321 - (21%)
Similarity:128/321 - (39%) Gaps:80/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72
            :...||:||:|..:.::||:|||..||.:.||||||::|:|...|..|.:|.::|:|...|.|||
plant     4 ETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSDSGQRQAYD 68

  Fly    73 KVLKAKKAAE------------------------------------LRSRQLDGKRQKLKLELEE 101
            ...|:..:.:                                    ....|.|.|:.:.||.:.:
plant    69 ACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQFDTKKIQEKLRIVQ 133

  Fly   102 RERA-ALHKLAKSQPYSTVAKSDEEVLHEQIERLR-------------------REGSRLLEEEQ 146
            :||. .|.::.|.:....|...||.:.:.:.|..|                   |:.::.|.::.
plant   134 KEREDKLAQILKDRLNEYVINKDEFISNAEAEVARLSNAAYGVDMLNTIGYIYVRQAAKELGKKA 198

  Fly   147 -----RAMQEQFR-RNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQELLKYLKKYGDVV 205
                 ..:.|.|| :.|..:.:|......:...|.:.:||.:.....:||::||.:||:.:..| 
plant   199 IYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKRQLNTEGNYTEEELEEYLQAHKRV- 262

  Fly   206 ALVVNSKRRGRAMVELATREACDMVLAYEKGDPAKPLHFEWVTPPAADKQTTKSATTGCSA 266
             ::.:..:...|.:|......|.:||                ..|.|.::..::...|..|
plant   263 -MIDSLWKLNVADIEATLCRVCQLVL----------------QDPEAKREELRTRARGLKA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 27/61 (44%)
RRM_DNAJC17 175..247 CDD:240875 14/71 (20%)
AT1G76700NP_177796.1 DnaJ 6..68 CDD:395170 27/61 (44%)
DnaJ-X 133..315 CDD:405064 35/192 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.