DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AT5G27240

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001318662.1 Gene:AT5G27240 / 832782 AraportID:AT5G27240 Length:1104 Species:Arabidopsis thaliana


Alignment Length:409 Identity:77/409 - (18%)
Similarity:132/409 - (32%) Gaps:141/409 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASKKYSDV-NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDE 65
            |.||.:.: |.|.:|.:...:|...|:|..||.||..||||| ..|.|...|..:..|...|.|:
plant    57 AEKKINCLENWYGILQVMHFADDATIKKQVRKLALLLHPDKN-QFPGAEAAFKLVWDASRFLADK 120

  Fly    66 SARAAYDKVLKAKKAAELRSRQLD------------------------GKRQKL----------- 95
            ..|:.||  ::.:....|.:.||:                        |.|.|.           
plant   121 DKRSQYD--IRRRIYLRLATNQLNANSGLQCAATNSATDTFWTCCEHCGYRYKYLRKYVNILLNC 183

  Fly    96 -------------------KLELEERE-------RAALHKLAKS---QPYSTVAKSDEEVLHEQI 131
                               |....::|       ..:|:...:|   ||.|..|:.|::....:.
plant   184 NICQRSYMAYDTGFNEAPSKSNTGQKEVQNQGPCNTSLNTNGESIGAQPGSVAAEVDKKGTFNKK 248

  Fly   132 ERLRREG--SRLLEEEQRAMQEQFRRNHAEQQ-----KLQQQPVQF------------------- 170
            ...|..|  |:..|.:...::.:|.||..|::     ||.:...:.                   
plant   249 FNKRNGGGESKKTEVKNSKIETEFVRNDDEEKMKSAAKLHKPHPEVTEPEIGASKSVPDESVSRS 313

  Fly   171 ----DSAQHRIKMKWKAE-----PGQDYTQQELLKYLKKYGDVVALVVNSKRRGRAMVELATREA 226
                .:::.:.|||...|     .|.|:.:.:  .|.|.         |:||:.....:.::...
plant   314 DEAPSTSKDKNKMKKGVEESINVDGSDFIKDK--AYSKD---------NNKRKSPRRSQQSSYAE 367

  Fly   227 CDMVLAYEKGDPAKPLHFEWVTPPAADKQTTKSATTGCSAS------------------------ 267
            .:.:.....|.|.|.|.   .......:|||:....|..:|                        
plant   368 EEKISDNSLGPPKKRLR---SNVGLKSEQTTRKGLVGVGSSKRFDSGGGSSAPSCAFKRKAKKFV 429

  Fly   268 STDYEDLVMRKLRQAEERK 286
            .:.|:::...|.::.|.||
plant   430 DSGYQEISSVKDKEREVRK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 22/61 (36%)
RRM_DNAJC17 175..247 CDD:240875 15/76 (20%)
AT5G27240NP_001318662.1 DnaJ 66..127 CDD:395170 22/61 (36%)
infB 238..>356 CDD:177089 22/128 (17%)
DUF3444 474..668 CDD:403213
DUF3444 883..1075 CDD:403213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.