DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AT5G22080

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_680194.1 Gene:AT5G22080 / 832269 AraportID:AT5G22080 Length:246 Species:Arabidopsis thaliana


Alignment Length:228 Identity:53/228 - (23%)
Similarity:102/228 - (44%) Gaps:59/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESAR----- 68
            :|.::.|.:|.:|..:::::.|||.:|..|||| ..:|:|.|.|..|:||.::|.::..|     
plant    37 LNPFEHLNLSFDSSTDDVKRQYRKISLMVHPDK-CKHPQAQEAFGALAKAQQLLLNDQERDYILT 100

  Fly    69 ---AAYD-------KVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSD 123
               ||.:       |.||...|::::|...:||.:.:..:.||.::....|:             
plant   101 QVHAAKEELKMKRKKQLKKDTASKIKSLVDEGKHEHIYEQSEEFQKELKLKV------------- 152

  Fly   124 EEVLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQ----QKLQQQPVQFDSAQHRIKMKWK-- 182
            .|:|.:|..|.|:...|:.|||.|     .:::.|||    :|.::...|::..:.:....|:  
plant   153 REILTDQEWRRRKMAMRISEEEGR-----LKKDEAEQKEIWKKKREHEEQWEGTREKRVSSWRDF 212

  Fly   183 -------------------AEPGQDYTQQELLK 196
                               .:|.:.|.|:.:.|
plant   213 QKAGKKAKKGETRPPKLKTEDPNKSYVQRPVKK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 23/69 (33%)
RRM_DNAJC17 175..247 CDD:240875 5/43 (12%)
AT5G22080NP_680194.1 DnaJ 38..91 CDD:99751 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3927
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.