DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AT5G18750

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_197376.1 Gene:AT5G18750 / 831993 AraportID:AT5G18750 Length:884 Species:Arabidopsis thaliana


Alignment Length:343 Identity:70/343 - (20%)
Similarity:117/343 - (34%) Gaps:100/343 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESAR 68
            |...:.:.|.:|.:...:|:|.|:|.|:|.||..||||| ..|.|...|..:.:|..:|.|:..|
plant    60 KSGDETDWYKILQVEQTADENTIKKQYKKLALHLHPDKN-KLPGAESAFKTIGEAQRVLLDKDKR 123

  Fly    69 AAYD----KVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHE 129
            ..:|    .|.:....|...:......:|                 |.:.|:.|           
plant   124 RFHDMRRKPVFRRPAPAPAPAPSFQPPQQ-----------------APTTPFFT----------- 160

  Fly   130 QIERLRREGSRLLEEEQRAMQEQF---RRNHAEQQKLQQQPVQFDSAQ---------HRIKMKWK 182
                            ||..|...   |:....|:|.|.||..||...         ||   |::
plant   161 ----------------QRGFQTNVNVARKRPENQKKPQAQPTGFDGLASFTTSCAFCHR---KYE 206

  Fly   183 AEPGQDYTQQELLKYLKKYGDVVAL------------------VVNSKRRGRAMVELATREACDM 229
            .:.....|....|...|:|   ||.                  .|.::..|:|:.:  ..|:|..
plant   207 YQRKLINTLMTCLNCGKQY---VAFQETFQPPVQPTFSFFQQSKVPTQEAGKAVEK--QPESCAK 266

  Fly   230 VLAYEKGDPAKP--LHFEWVTPPAADKQTTKSATTGCSASSTDYEDL-----------VMRKLRQ 281
            ....::|..||.  :..|.:......|:..:|:.:.||.||.|..::           .....|.
plant   267 SFFSKEGSRAKSSGVSAENINGKRKRKKVVESSDSSCSESSIDCNEVPAGGQDSGSSGAQHSRRS 331

  Fly   282 AEERKRLIEQMMKDEEGE 299
            ...::::..:..|:|:.|
plant   332 VRSKQQVSYKEDKEEDAE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 22/61 (36%)
RRM_DNAJC17 175..247 CDD:240875 18/91 (20%)
AT5G18750NP_197376.1 DnaJ 66..127 CDD:395170 22/61 (36%)
DUF3444 392..605 CDD:403213
DUF3444 653..861 CDD:403213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.