DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and ATJ6

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_196308.1 Gene:ATJ6 / 830582 AraportID:AT5G06910 Length:284 Species:Arabidopsis thaliana


Alignment Length:317 Identity:70/317 - (22%)
Similarity:111/317 - (35%) Gaps:108/317 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAY 71
            |:.:||::||:...:...||||||.|.||:.|||||.|:.:|.::|.:|.|.:.||.||..||.|
plant    26 SETSLYEVLGVERRATSQEIRKAYHKLALKLHPDKNQDDKEAKDKFQQLQKVISILGDEEKRAVY 90

  Fly    72 DKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIERLRR 136
            |:                                            |.:..|.::..:..|.||.
plant    91 DQ--------------------------------------------TGSIDDADIPGDAFENLRD 111

  Fly   137 EGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQELLKYLKKY 201
            ....:.::...|..|:|..|:.                           |.:..:::||:...|:
plant   112 FFRDMYKKVNEADIEEFEANYR---------------------------GSESEKKDLLELFNKF 149

  Fly   202 -GDVVALV---------VNSKRRGRAMVELATREACDMVLAYEKGDPAKPLHFEWVT------PP 250
             |.:..|.         ::|.|....:.|...........||||          |..      ||
plant   150 KGKMNRLFCSMLCSDPKLDSHRFKDMLDEAIAAGEVKSSKAYEK----------WANKISETKPP 204

  Fly   251 AADKQTTKSATTGCSASSTDYEDLVMRKLRQAEERKRLIEQMMK--------DEEGE 299
            .:..:..|...:....|.|   ||.:...::.||||..::.|..        |.|.|
plant   205 TSPLRKRKKKKSAAKDSET---DLCLMIAKRQEERKGKVDSMFSSLISRYGGDAEAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 29/61 (48%)
RRM_DNAJC17 175..247 CDD:240875 13/81 (16%)
ATJ6NP_196308.1 DnaJ 29..91 CDD:395170 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3359
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.