DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and J20

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_193119.1 Gene:J20 / 827017 AraportID:AT4G13830 Length:197 Species:Arabidopsis thaliana


Alignment Length:172 Identity:44/172 - (25%)
Similarity:70/172 - (40%) Gaps:50/172 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVE----RFHELSKALEILTD 64
            |:..|::.|||||::......||::||::.|.:.|||.:|  |..||    ||..:.:|.|.|:|
plant    60 KQSEDLSFYDLLGVTESVTLPEIKQAYKQLARKYHPDVSP--PDRVEEYTDRFIRVQEAYETLSD 122

  Fly    65 ESARAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHE 129
            ...|..||:.|...     .|....|:||.                          :.|:||:.|
plant   123 PRRRVLYDRDLSMG-----FSFSFSGRRQN--------------------------RYDQEVVEE 156

  Fly   130 ----------QIERLRREGSRLLEEEQRAMQEQFRRNHAEQQ 161
                      |:..|||..:   :::...|....|....:|:
plant   157 KSEWKAKWQTQLSGLRRRSN---QKDNNTMSWAARMRRQQQE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 24/65 (37%)
RRM_DNAJC17 175..247 CDD:240875
J20NP_193119.1 DnaJ 66..>143 CDD:223560 28/83 (34%)
DnaJ 66..130 CDD:278647 24/65 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.