DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and TPR15

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_850351.1 Gene:TPR15 / 818750 AraportID:AT2G41520 Length:1108 Species:Arabidopsis thaliana


Alignment Length:135 Identity:35/135 - (25%)
Similarity:55/135 - (40%) Gaps:35/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDK--------NPDNP----------KAV 49
            ||:...::.:.::|:.......:|:|||||.||..||||        ..:.|          |..
plant   971 SKEGIHLDFFLIMGVKTSDSAADIKKAYRKAALRHHPDKAAQILVRSESEGPWLKEILEEVHKGA 1035

  Fly    50 ER-FHELSKALEILTDESARAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKS 113
            :| |..:.:|..:|:|.:.|:.|:...:.:||...|.              ..|.|.|..  |.|
plant  1036 DRLFKMIGEAYSVLSDPTKRSDYELEEEIRKARASRE--------------SYRSRKAAE--ASS 1084

  Fly   114 QPYST 118
            .||.|
plant  1085 PPYQT 1089

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 21/80 (26%)
RRM_DNAJC17 175..247 CDD:240875
TPR15NP_850351.1 TPR repeat 553..581 CDD:276809
TPR_11 554..628 CDD:290150
TPR repeat 586..626 CDD:276809
TPR_1 597..630 CDD:278916
TPR_16 603..656 CDD:290168
TPR repeat 631..659 CDD:276809
TPR_11 835..901 CDD:290150
TPR repeat 835..860 CDD:276809
TPR repeat 869..899 CDD:276809
TPR_11 870..933 CDD:290150
TPR repeat 904..932 CDD:276809
DnaJ 978..1059 CDD:278647 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.