DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AT2G35540

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_181097.2 Gene:AT2G35540 / 818119 AraportID:AT2G35540 Length:590 Species:Arabidopsis thaliana


Alignment Length:344 Identity:76/344 - (22%)
Similarity:129/344 - (37%) Gaps:102/344 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            |.:|.:...|..|.|::.|||.||..|||||| .....|.|..|::|..:.:|:..|..||..|:
plant    73 YKVLKVEPFSHINTIKQQYRKLALVLHPDKNP-YVGCEEGFKLLNEAFRVFSDKVRRTEYDMKLR 136

  Fly    77 AKKAAELRS---------------------RQLDGK----------------RQKLKLELEERER 104
            .:...|:.|                     .:.|.|                .::::.|.|.||.
plant   137 IRIQGEMVSGGSGGDETSTFSAVCSGCRSVHKFDRKYLGQNLMCPTCKNSFEAKEVEKEEEGREN 201

  Fly   105 AALHKLAKSQPYSTVAK---SDEEVLHEQIE--RLRREGSRLL-------EEEQ-----RAMQEQ 152
            .|.  .:|...||...:   ||.|.|.:::|  .:.:|.:..:       ||::     ..||..
plant   202 GAC--TSKIITYSRRKRPVDSDGESLIKEVETGEMSQEAAEAINVFEGSDEEDEGMMTLAEMQAV 264

  Fly   153 FRRNHAEQQKLQQQPVQFDSA-QHRIKMKWKAEPGQDYTQQELLKYLKKYGDVVALVVNSKRRGR 216
            .:||   :.|:..:..:.||: :..:..:.:.....|.:..|.|:      ::....||:|:.  
plant   265 IKRN---KSKVNSKITEKDSSGEENMGRETQKRSLADASMTETLR------EMSTNAVNNKQE-- 318

  Fly   217 AMVELATREACDMVLAYEKGDPAKPLHFEWVTPPAADKQTTKSATTGCSASSTDYEDLVMRKLRQ 281
                         ||...|....|.:        |..|..|:..       ..:|...|.||   
plant   319 -------------VLKNRKNIKKKKM--------ANHKDLTEIV-------DLEYVPRVDRK--- 352

  Fly   282 AEERKRLIEQM-MKDEEGE 299
             .:|.:|.::| |:||:.|
plant   353 -RDRGKLSQEMYMEDEDFE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 22/59 (37%)
RRM_DNAJC17 175..247 CDD:240875 10/71 (14%)
AT2G35540NP_181097.2 DnaJ 71..132 CDD:395170 22/59 (37%)
DUF3444 362..565 CDD:403213 5/9 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.