DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AT2G21510

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001324689.1 Gene:AT2G21510 / 816690 AraportID:AT2G21510 Length:353 Species:Arabidopsis thaliana


Alignment Length:305 Identity:73/305 - (23%)
Similarity:130/305 - (42%) Gaps:66/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72
            :...|::||:..::...||:|||..||.:.||||||.:|:|.:.|..|.:|.::|::...|||||
plant     4 ETEYYEILGVKTDASDAEIKKAYYLKARKVHPDKNPGDPQAAKNFQVLGEAYQVLSNPDKRAAYD 68

  Fly    73 KVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYS--------TVAKSDEEVLHE 129
            |..|            :|.:|...::    ..|....|..|:.:.        ....|.|..|..
plant    69 KYGK------------EGVQQDAMVD----PAAVFGMLFGSEVFEEYVGQLALAYLASIEADLES 117

  Fly   130 QIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQEL 194
            ....:|::   :|:::.:|:|::      .:.||            ...:|.|.||..:....|.
plant   118 HDPEIRKQ---MLQDKIKALQKE------REDKL------------AATLKNKLEPFVERQTDEF 161

  Fly   195 LKYLKKYGDVVALVVNSKRRGRAMVE----LATREACDMVLAYEKGDPAK----PLHFEWVTPPA 251
            :::..:    .|..::|...|.||:.    :.||:|     |.|.|...:    |...|||....
plant   162 IEWANE----EAKRLSSAGFGEAMMHTIGYIYTRKA-----AKEIGKDKRYMKVPFLAEWVRDKG 217

  Fly   252 ADKQTTKSATTGCSASSTDYEDLVMRKL--RQAEERKRLIEQMMK 294
            ...::...|.:| :.|....:|.| .||  .|.|.::..|::.::
plant   218 HHMKSQVMAASG-AVSLLQLQDEV-NKLNEHQGENKEEHIQKAIE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/61 (41%)
RRM_DNAJC17 175..247 CDD:240875 18/79 (23%)
AT2G21510NP_001324689.1 DnaJ 2..>92 CDD:223560 33/103 (32%)
DnaJ-X 135..325 CDD:405064 33/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.