Sequence 1: | NP_650056.1 | Gene: | CG17187 / 41351 | FlyBaseID: | FBgn0037882 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026893.1 | Gene: | DNAJB14 / 79982 | HGNCID: | 25881 | Length: | 379 | Species: | Homo sapiens |
Alignment Length: | 273 | Identity: | 56/273 - (20%) |
---|---|---|---|
Similarity: | 107/273 - (39%) | Gaps: | 81/273 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKV 74
Fly 75 LKAKKA----------------AELRSRQL------------------DGK-----RQKLKLELE 100
Fly 101 ERER----------------------AALHKLAKSQ-PYSTVAKSDE-EVLHEQIERL------- 134
Fly 135 ----RREGSRLLEEEQRAMQEQF---RRNHAEQQKLQQQPVQFDSAQH---RIKMKWKAEPGQDY 189
Fly 190 TQQELLKYLKKYG 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17187 | NP_650056.1 | DnaJ | 10..72 | CDD:278647 | 22/61 (36%) |
RRM_DNAJC17 | 175..247 | CDD:240875 | 8/31 (26%) | ||
DNAJB14 | NP_001026893.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 55..94 | ||
DnaJ | 107..>214 | CDD:223560 | 27/106 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..241 | 4/21 (19%) | |||
DUF1977 | 271..371 | CDD:370429 | 18/99 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |