DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and DNAJB14

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001026893.1 Gene:DNAJB14 / 79982 HGNCID:25881 Length:379 Species:Homo sapiens


Alignment Length:273 Identity:56/273 - (20%)
Similarity:107/273 - (39%) Gaps:81/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKV 74
            |.|::||::.::...:::|||||.||:.||||| ..|.|.:.|.::..|..:|::...|..||..
Human   108 NYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKN-HAPGATDAFKKIGNAYAVLSNPEKRKQYDLT 171

  Fly    75 LKAKKA----------------AELRSRQL------------------DGK-----RQKLKLELE 100
            ...::|                |::....|                  :|:     :.:.:....
Human   172 GNEEQACNHQNNGRFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAGYSQQHQHRHSGH 236

  Fly   101 ERER----------------------AALHKLAKSQ-PYSTVAKSDE-EVLHEQIERL------- 134
            |||.                      :.|.:|..|. |||...:|.. :.:..|.|.|       
Human   237 EREEERGDGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGTGQTIKMQTENLGVVYYVN 301

  Fly   135 ----RREGSRLLEEEQRAMQEQF---RRNHAEQQKLQQQPVQFDSAQH---RIKMKWKAEPGQDY 189
                ......||::.:::::|.:   .||:..:::.|:..:|:.:..:   |::.|..|....:.
Human   302 KDFKNEYKGMLLQKVEKSVEEDYVTNIRNNCWKERQQKTDMQYAAKVYRDDRLRRKADALSMDNC 366

  Fly   190 TQQELLKYLKKYG 202
            .:.|.|..|.|.|
Human   367 KELERLTSLYKGG 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 22/61 (36%)
RRM_DNAJC17 175..247 CDD:240875 8/31 (26%)
DNAJB14NP_001026893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..94
DnaJ 107..>214 CDD:223560 27/106 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..241 4/21 (19%)
DUF1977 271..371 CDD:370429 18/99 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.