DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnajc12

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001314717.1 Gene:dnajc12 / 797196 ZFINID:ZDB-GENE-070801-3 Length:165 Species:Danio rerio


Alignment Length:131 Identity:45/131 - (34%)
Similarity:66/131 - (50%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            |.|||....|...:|...::.|||.|||||:|:||||||:|.:|.:|.|:||||..|.:||..| 
Zfish    16 YGLLGCDELSTTEQIVNEFKVKALACHPDKHPENPKAVEQFQKLQEAKEVLTDEKKRKSYDLWL- 79

  Fly    77 AKKAAELRSRQLDGKRQKLKL------ELEERERAALH--KLAKSQPYSTVAK----SDEEVLHE 129
                           |.::|:      .|.:..:.::|  ..||.:|....|:    |||..:.|
Zfish    80 ---------------RSQIKIPFGEWRALSDSVKTSMHWAVKAKKEPMLEAAEDSNPSDENTVQE 129

  Fly   130 Q 130
            :
Zfish   130 K 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 30/59 (51%)
RRM_DNAJC17 175..247 CDD:240875
dnajc12NP_001314717.1 DnaJ 14..76 CDD:278647 30/59 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.