Sequence 1: | NP_650056.1 | Gene: | CG17187 / 41351 | FlyBaseID: | FBgn0037882 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343292.1 | Gene: | Dnajb4 / 67035 | MGIID: | 1914285 | Length: | 337 | Species: | Mus musculus |
Alignment Length: | 285 | Identity: | 63/285 - (22%) |
---|---|---|---|
Similarity: | 110/285 - (38%) | Gaps: | 99/285 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKV-- 74
Fly 75 --LK----------------------AKKAAELR---------SRQLDGKRQKLKLELEERERAA 106
Fly 107 LHKLAKSQPYSTVA------------------KSDEEVLHE---QIERLRREGSRLLEEEQRAMQ 150
Fly 151 EQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWK-----AEPGQ-DYTQQELLKYLKKYGDVVALVV 209
Fly 210 NS-----KRRGRAMV---ELATREA 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17187 | NP_650056.1 | DnaJ | 10..72 | CDD:278647 | 26/59 (44%) |
RRM_DNAJC17 | 175..247 | CDD:240875 | 16/66 (24%) | ||
Dnajb4 | NP_001343292.1 | DnaJ | 1..332 | CDD:223560 | 63/285 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |