DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajb4

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001343292.1 Gene:Dnajb4 / 67035 MGIID:1914285 Length:337 Species:Mus musculus


Alignment Length:285 Identity:63/285 - (22%)
Similarity:110/285 - (38%) Gaps:99/285 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKV-- 74
            |.:|||...:...:::|||||:||:.||||| .:|:|.|:|.|:::|.|:|:|...|..||:.  
Mouse     6 YHILGIDKGATDEDVKKAYRKQALKFHPDKN-KSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGE 69

  Fly    75 --LK----------------------AKKAAELR---------SRQLDGKRQKLKLELEERERAA 106
              ||                      |..||...         .|::.|.|...::|::      
Mouse    70 EGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEID------ 128

  Fly   107 LHKLAKSQPYSTVA------------------KSDEEVLHE---QIERLRREGSRLLEEEQRAMQ 150
                  ..|:|...                  |.|..::||   .:|.:....::.::..::.:.
Mouse   129 ------GDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIYSGCTKRMKISRKRLN 187

  Fly   151 EQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWK-----AEPGQ-DYTQQELLKYLKKYGDVVALVV 209
            ...|...:|.:.|..:          ||..||     ..|.: |.|...:      ..|:|.::.
Mouse   188 PDGRSYRSEDKILTIE----------IKKGWKEGTKITFPREGDETPNSI------PADIVFVIK 236

  Fly   210 NS-----KRRGRAMV---ELATREA 226
            :.     ||.|..:|   :::.|||
Mouse   237 DKEHPKFKRDGSNIVYTAKISLREA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 26/59 (44%)
RRM_DNAJC17 175..247 CDD:240875 16/66 (24%)
Dnajb4NP_001343292.1 DnaJ 1..332 CDD:223560 63/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.