DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc10

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_077143.2 Gene:Dnajc10 / 66861 MGIID:1914111 Length:793 Species:Mus musculus


Alignment Length:67 Identity:33/67 - (49%)
Similarity:46/67 - (68%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAY 71
            :|.|.|.|||:|..:...|||:|::|.||:.||||||:||.|...|.::::|.|:|.||..|..|
Mouse    32 TDQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKY 96

  Fly    72 DK 73
            ||
Mouse    97 DK 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 29/61 (48%)
RRM_DNAJC17 175..247 CDD:240875
Dnajc10NP_077143.2 DnaJ 34..>132 CDD:223560 32/65 (49%)
DnaJ 35..97 CDD:278647 29/61 (48%)
PDI_a_ERdj5_N 129..229 CDD:239301
ER_PDI_fam 130..551 CDD:273457
Trxb 1 235..350
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302
PDI_a_ERdj5_C 556..663 CDD:239302
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.