DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc30

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_079638.2 Gene:Dnajc30 / 66114 MGIID:1913364 Length:219 Species:Mus musculus


Alignment Length:175 Identity:47/175 - (26%)
Similarity:71/175 - (40%) Gaps:39/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESAR 68
            :.||...||:|||:...:.|.:|:.||.:::...|||:||.:.:|.|||..:|:|..:|.....|
Mouse    36 RTYSRTALYELLGVPSTATQAQIKAAYYRQSFLYHPDRNPGSAEAAERFTRVSEAYLVLGSTILR 100

  Fly    69 AAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPY-------STVAKSDEEV 126
            ..||:.|       |..:.|.|...|     ..:...|.....:..||       |..:..|...
Mouse   101 RKYDRGL-------LSDQDLRGPGVK-----PSKTPVADPAPPRPPPYTPRAPGGSRASPGDGRT 153

  Fly   127 LH-----------EQIERLRREGSRLLEEEQRAMQEQFRRNHAEQ 160
            :.           ||:||.||         .||.:|..|:....|
Mouse   154 MFDFDAFYQAHYGEQLERERR---------LRARREALRKKQENQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 22/61 (36%)
RRM_DNAJC17 175..247 CDD:240875
Dnajc30NP_079638.2 DnaJ 43..104 CDD:278647 22/60 (37%)
DnaJ 44..>105 CDD:223560 22/60 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..148 7/43 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.