DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc12

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001029204.1 Gene:Dnajc12 / 619393 RGDID:1591898 Length:198 Species:Rattus norvegicus


Alignment Length:213 Identity:55/213 - (25%)
Similarity:90/213 - (42%) Gaps:55/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            |.|||....|...:|...::.:||||||||:|:|.||||.|.:|.||.|||::..:||.||    
  Rat    16 YTLLGCDELSSVEQILAEFKVRALECHPDKHPENSKAVETFQKLQKAKEILSNAESRARYD---- 76

  Fly    77 AKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIERLRREGS-- 139
                        ..:|.::.:..|:.| |....:..|..::..:|.|          |..|||  
  Rat    77 ------------HWRRSQMSMSFEQWE-ALADSVKTSMHWAVRSKKD----------LMLEGSEQ 118

  Fly   140 ---RLLEEEQRAMQEQFRRNHAE------QQKLQQQPVQFDSAQH------------RIKMKWKA 183
               ...:.::|:.|.:.::...:      .||..:.|.:..|.|:            .:..:|..
  Rat   119 TYTNTAQNKERSEQRETKQGDPDSTPEKMMQKESESPEKGISPQNPDSPGLSDWNCGHLHFRWSG 183

  Fly   184 EPGQDYTQQELLKYLKKY 201
            :     |..|||:..:.|
  Rat   184 D-----TPSELLRKFRNY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 29/59 (49%)
RRM_DNAJC17 175..247 CDD:240875 6/39 (15%)
Dnajc12NP_001029204.1 DnaJ 14..76 CDD:278647 29/59 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..183 8/61 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.