DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and DNAJC12

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_068572.1 Gene:DNAJC12 / 56521 HGNCID:28908 Length:198 Species:Homo sapiens


Alignment Length:199 Identity:57/199 - (28%)
Similarity:94/199 - (47%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            |.|||....|...:|...::.:||||||||:|:||||||.|.:|.||.||||:|.:||.||...:
Human    16 YTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRR 80

  Fly    77 AKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIERLRREGSRL 141
            ::.:  :..:|.:.....:|..:....|.....:.:....:...|.:.|..:||.||.:.|.:..
Human    81 SQMS--MPFQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEELAST 143

  Fly   142 LEE-EQRAMQEQFRRNHAEQQKLQQ--QPVQFDSAQH------RIKMKWKAEPGQDYTQQELLKY 197
            .|: ||:           |.:.|::  .|...||:..      .::.:|..:     ...|||:.
Human   144 AEKTEQK-----------EPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKD-----APSELLRK 192

  Fly   198 LKKY 201
            .:.|
Human   193 FRNY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 32/59 (54%)
RRM_DNAJC17 175..247 CDD:240875 5/33 (15%)
DNAJC12NP_068572.1 CbpA 9..>164 CDD:225124 50/160 (31%)
DnaJ 14..76 CDD:306689 32/59 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..169 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.