DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and DNAJA4

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_061072.3 Gene:DNAJA4 / 55466 HGNCID:14885 Length:426 Species:Homo sapiens


Alignment Length:297 Identity:71/297 - (23%)
Similarity:123/297 - (41%) Gaps:85/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESAR 68
            |...:...||:||:...:...||:|||||.||:.|||||||..   |:|..:|:|.|:|:|...|
Human    29 KMVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEG---EKFKLISQAYEVLSDPKKR 90

  Fly    69 AAYDK-----VLKAKKAAELRSRQLD--------GKRQKLKLELEERERAALHKLAKS--QPYST 118
            ..||:     :.:....:...|..:|        |.|    :..|.|.:..:|:|:.:  ..|:.
Human    91 DVYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGGR----MARERRGKNVVHQLSVTLEDLYNG 151

  Fly   119 VAKS---DEEVLHEQIERL-RREGSRLLEE----EQRAMQEQFRRNHAEQ------QKLQQQPVQ 169
            |.|.   .:.|:.|:.|.: .::||  :|:    :.|.||     .|.:|      |::|...::
Human   152 VTKKLALQKNVICEKCEGVGGKKGS--VEKCPLCKGRGMQ-----IHIQQIGPGMVQQIQTVCIE 209

  Fly   170 FDSAQHRIKMKWKAEP------------------------------GQDYTQQELLKYLKKYGDV 204
            ......||..|.:.|.                              |:...:.||     :.|||
Human   210 CKGQGERINPKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPEL-----EPGDV 269

  Fly   205 VALVVNSK------RRGRAMVELATREACDMVLAYEK 235
            : :|::.|      |||..::.....:..:.:..::|
Human   270 I-IVLDQKDHSVFQRRGHDLIMKMKIQLSEALCGFKK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 28/61 (46%)
RRM_DNAJC17 175..247 CDD:240875 16/97 (16%)
DNAJA4NP_061072.3 PTZ00037 15..423 CDD:240236 71/297 (24%)
DnaJ 36..94 CDD:278647 28/60 (47%)
DnaJ_C 135..361 CDD:199909 34/184 (18%)
DnaJ_zf 164..230 CDD:199908 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.