DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnajc1

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001071003.1 Gene:dnajc1 / 553324 ZFINID:ZDB-GENE-061103-529 Length:526 Species:Danio rerio


Alignment Length:317 Identity:72/317 - (22%)
Similarity:134/317 - (42%) Gaps:53/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SDVNLYDL-----------LGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALE 60
            :|:.|:||           |.::.::..:||||||||.:|..|||||.|. .|..:|.:|....|
Zfish    28 ADLELFDLVEEIPQTFYEFLSVNQDASSSEIRKAYRKLSLILHPDKNKDE-NAENQFRQLVAIYE 91

  Fly    61 ILTDESARAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKS--- 122
            :|.||..|..||.:| .....:.|......:|.:   ::...|...|..|..:..:..|..|   
Zfish    92 VLKDEERRQRYDDIL-VNGLPDWRQPVFYYRRVR---KMSNGELGFLLFLILTVGHYAVIWSIYL 152

  Fly   123 ----DEEVLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKW-- 181
                ||.:..::.|:.:::.|::.:|.:...|::..|:        .:|...|....::.: |  
Zfish   153 EKQLDELLSRKKREKKKKQTSKMTDEMKPLAQDKNERS--------DRPHWHDILPLKLSI-WLY 208

  Fly   182 ---KAEPGQDYTQQELLKYLKKYGDVVALVVNSKRRGRAMVELATREACDMVLAYEKGDPAKPLH 243
               |:.|   :..|::.:|.|.|.:   :.|..|....|:.|...::.       ||....|...
Zfish   209 YSIKSLP---HIIQDVKQYYKDYKE---MKVKEKEEAEALAEQEMQQK-------EKRPKVKKTK 260

  Fly   244 FEW-VTPPAADKQTTKSATTGCSASSTDYEDLVMRKLRQAEERKRLIEQMMKDEEGE 299
            .|: |..|:|:.....:...|.|..  :.||.:...|...::.|:..::..:|:..:
Zfish   261 VEFPVYEPSANAAFALAYDQGTSIE--EIEDQMDDWLEDKKQLKKKTQEWTEDDHSQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 27/72 (38%)
RRM_DNAJC17 175..247 CDD:240875 15/77 (19%)
dnajc1NP_001071003.1 DnaJ 42..103 CDD:278647 24/61 (39%)
SANT 307..353 CDD:238096 1/9 (11%)
SANT 469..514 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.