DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and DNAJC17

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_016877890.1 Gene:DNAJC17 / 55192 HGNCID:25556 Length:308 Species:Homo sapiens


Alignment Length:288 Identity:129/288 - (44%)
Similarity:186/288 - (64%) Gaps:26/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLKAKKAAELRSRQLD 89
            :::||||:|||.||||||||||:|.|.||:||:|||:|||.:||||||||.||||.|..|:::||
Human    30 QVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARAAYDKVRKAKKQAAERTQKLD 94

  Fly    90 GKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIERLRREGSRLLEEEQRAMQEQFR 154
            .||:|:||:||.|||.|..:.::.:..|...::    |.::|||||.||||.|||:||.::||.|
Human    95 EKRKKVKLDLEARERQAQAQESEEEEESRSTRT----LEQEIERLREEGSRQLEEQQRLIREQIR 155

  Fly   155 -------RNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQD----YTQQELLKYLKKYGDVVALV 208
                   |..||..:.|..|        ::|:|||.:...:    |::..||:.|:|||:|:.||
Human   156 QERDQRLRGKAENTEGQGTP--------KLKLKWKCKKEDESKGGYSKDVLLRLLQKYGEVLNLV 212

  Fly   209 VNSKRRGRAMVELATREACDMVLAYEKGDPAKPLHFEWV--TPPAADKQTTKSATTGCSASSTDY 271
            ::||:.|.|:||.||.:|.::.:..|.|....||...|:  .|..|..::....:.|...|..||
Human   213 LSSKKPGTAVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDY 277

  Fly   272 EDLVMRKLRQAEERKRLIEQM-MKDEEG 298
            |.|||.::|||.||::||.:| .:|:||
Human   278 ESLVMMRMRQAAERQQLIARMQQEDQEG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 33/46 (72%)
RRM_DNAJC17 175..247 CDD:240875 27/75 (36%)
DNAJC17XP_016877890.1 DnaJ <30..77 CDD:278647 33/46 (72%)
RRM_DNAJC17 188..251 CDD:240875 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146980
Domainoid 1 1.000 94 1.000 Domainoid score I7509
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49527
Inparanoid 1 1.050 235 1.000 Inparanoid score I3407
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55085
OrthoDB 1 1.010 - - D1405648at2759
OrthoFinder 1 1.000 - - FOG0005507
OrthoInspector 1 1.000 - - oto91671
orthoMCL 1 0.900 - - OOG6_103146
Panther 1 1.100 - - LDO PTHR44313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R269
SonicParanoid 1 1.000 - - X3927
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.