DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AT3G06778

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001078117.1 Gene:AT3G06778 / 5007987 AraportID:AT3G06778 Length:229 Species:Arabidopsis thaliana


Alignment Length:201 Identity:46/201 - (22%)
Similarity:81/201 - (40%) Gaps:44/201 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDK 73
            ::.|.:|||..:::...|||.|.|.||:.||||| ::|||...|..:.:|...|:||:.|     
plant    41 IDWYLILGIQEDAEVKVIRKRYHKLALKVHPDKN-NHPKADIAFKLIHEAYLCLSDETKR----- 99

  Fly    74 VLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQP--YSTVAKSDEEVLHEQ---IER 133
                      ||..:| :|..:.|:.......:......|:|  :....|...:...|:   |||
plant   100 ----------RSFNID-RRNNICLKCSRVSHKSKENRNDSKPNRFCQTLKDIRDKFREENMVIER 153

  Fly   134 LRREGSRLLEEEQRAMQEQFRRNHA-------EQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQ 191
            ..:..|......        |.|..       :|.::.::...|:.:.:|:   |    |..:.:
plant   154 CLKTNSAFFMGN--------RTNETPPVYGIPKQNRINKESPVFNPSDYRL---W----GYPHVR 203

  Fly   192 QELLKY 197
            ..:..|
plant   204 NRVFDY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/61 (41%)
RRM_DNAJC17 175..247 CDD:240875 4/23 (17%)
AT3G06778NP_001078117.1 DnaJ 42..103 CDD:278647 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.