DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnaja1

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001011012.1 Gene:dnaja1 / 496421 XenbaseID:XB-GENE-976936 Length:400 Species:Xenopus tropicalis


Alignment Length:127 Identity:38/127 - (29%)
Similarity:58/127 - (45%) Gaps:44/127 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            ||:||:...|..:|::|||||.||:.||||||:..   |:|.::|:|.|:|:|...|..|||   
 Frog     8 YDILGVKPNSTPDELKKAYRKLALKYHPDKNPNEG---EKFKQISQAYEVLSDSKKRDLYDK--- 66

  Fly    77 AKKAAELRSRQLDGKRQKLK-------------------------LELEERERAALHKLAKS 113
                         |..|.:|                         ::.|.|.:..:|:|:.|
 Frog    67 -------------GGEQAIKEGGMGGGGFASPMDIFDMFFGGGGRMQRERRGKNVVHQLSVS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 27/59 (46%)
RRM_DNAJC17 175..247 CDD:240875
dnaja1NP_001011012.1 PTZ00037 7..397 CDD:240236 38/127 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.