DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17187 and AgaP_AGAP001859

DIOPT Version :9

Sequence 1:	NP_650056.1	Gene:	CG17187 / 41351	FlyBaseID:	FBgn0037882	Length:	299	Species:	Drosophila melanogaster
Sequence 2:	XP_001238449.2	Gene:	AgaP_AGAP001859 / 4577058	VectorBaseID:	AGAP001859	Length:	385	Species:	Anopheles gambiae

Alignment Length:	63	Identity:	30/63 - (47%)
Similarity:	42/63 - (66%)	Gaps:	1/63 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72
            :.|::||::.|:..:||:|.|:|.||:.||||| ..|.|:|.|..|..|:|.|||...|.|||
Mosquito   114 DFYEVLGVTQEATDSEIKKCYKKHALQLHPDKN-KAPGAMEAFKSLGNAVETLTDPQKRKAYD 175

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17187	NP_650056.1	DnaJ	10..72	CDD:278647	28/61 (46%)
CG17187	NP_650056.1	RRM_DNAJC17	175..247	CDD:240875
AgaP_AGAP001859	XP_001238449.2	DnaJ	113..>221	CDD:223560	30/63 (48%)
		DnaJ	114..175	CDD:278647	28/61 (46%)
		DUF1977	280..377	CDD:286411
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910