DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and CG10375

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651185.1 Gene:CG10375 / 42812 FlyBaseID:FBgn0039116 Length:254 Species:Drosophila melanogaster


Alignment Length:174 Identity:48/174 - (27%)
Similarity:88/174 - (50%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDN-PKAVERFHELSKALEILTDESARA 69
            |.::|.:::|.|..|.:..:|:|.||..::..|||||||| .:|...|..:|::.:||.:|..| 
  Fly    50 YFNLNPFEVLQIEPEVELADIKKRYRTLSILVHPDKNPDNQERAQMAFDIVSRSWKILENELTR- 113

  Fly    70 AYDKVLKAKKAAELRSRQLDG-KRQKLKLELEERERAALHKLAKSQP-------YSTVAK--SDE 124
              .:.|:..:.|:.|:.|:.. ||:|||     :|......:.:..|       |..|.|  :|.
  Fly   114 --KRCLEVYEEAKGRTDQMIAEKRKKLK-----KEGRPTEPIPEDDPTKYKHAIYVMVMKLFADM 171

  Fly   125 EVLHEQI------ERLRREGSRLLEEEQRAMQEQFRRNHAEQQK 162
            |...:::      ||.|:..:.:.|||:.....::::|..|.::
  Fly   172 ERRRQKLDQRDQEERKRKRETEIEEEERIKADREWQQNFEESRQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 23/62 (37%)
RRM_DNAJC17 175..247 CDD:240875
CG10375NP_651185.1 DnaJ 54..109 CDD:99751 21/54 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.