DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Droj2

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster


Alignment Length:414 Identity:84/414 - (20%)
Similarity:142/414 - (34%) Gaps:154/414 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72
            :...||:||:...:..:|::|||||.||:.||||||:..   |:|..:|:|.|:|:|...|..||
  Fly     4 ETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEG---EKFKAISQAYEVLSDADKRQVYD 65

  Fly    73 KVLKA---KKAAEL------------------------RSRQLDGKR--QKLKLELEERERAALH 108
            :..:|   |..|:.                        |.|:..||.  .::.::|||....|..
  Fly    66 EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATR 130

  Fly   109 KLAK----------------------------------------------------SQPYSTVAK 121
            ||..                                                    |....|:.:
  Fly   131 KLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQE 195

  Fly   122 SD-------------EEVLHEQIERLRREGSR--------------------LLEEEQRAMQEQF 153
            .|             .:||...||:..|:|.:                    ||:|::.:...  
  Fly   196 KDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFA-- 258

  Fly   154 RRNHAEQQKLQQQPVQFDSA----QHRIK------MKWKAEPGQDYTQQELLKYLKKYGDVVALV 208
               ||.|..:.:.|:|...|    |..:|      :....:|| :..:.|:.|.:.:.|  :.:.
  Fly   259 ---HAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPG-EVIRHEMTKCIAEEG--MPIF 317

  Fly   209 VNSKRRGRAMVELATREACDMVLAYEKGDPAKPLHFEWVTPPAADKQTTKSATTGCSASSTDYED 273
            .|...:|..:::..       |:..|..:|:.....:...|||.:      ......|..|..||
  Fly   318 KNPMEKGTLIIQFE-------VIFPEVINPSVVPTLKQCLPPAPE------VDIPIDAEQTVLED 369

  Fly   274 LVMRKLRQAEERKRLIEQMMKDEE 297
            ...::.||..:|      |..||:
  Fly   370 FDPKQRRQQHQR------MAYDED 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 26/61 (43%)
RRM_DNAJC17 175..247 CDD:240875 11/77 (14%)
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 84/414 (20%)
DnaJ 7..65 CDD:278647 26/60 (43%)
DnaJ_C 112..336 CDD:199909 34/238 (14%)
DnaJ_zf 140..206 CDD:199908 3/65 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.