DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17187 and Csp

DIOPT Version :9

Sequence 1:	NP_650056.1	Gene:	CG17187 / 41351	FlyBaseID:	FBgn0037882	Length:	299	Species:	Drosophila melanogaster
Sequence 2:	NP_001287144.1	Gene:	Csp / 40459	FlyBaseID:	FBgn0004179	Length:	249	Species:	Drosophila melanogaster

Alignment Length:	63	Identity:	29/63 - (46%)
Similarity:	46/63 - (73%)	Gaps:	0/63 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72
            :||::||:...:..::|:|.|||.||:.||||||||..|.::|.|:::|..||:|::.|..||
  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYD 79

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17187	NP_650056.1	DnaJ	10..72	CDD:278647	27/61 (44%)
CG17187	NP_650056.1	RRM_DNAJC17	175..247	CDD:240875
Csp	NP_001287144.1	DnaJ	17..>86	CDD:223560	29/63 (46%)
Csp	NP_001287144.1	DnaJ	17..79	CDD:278647	27/61 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45464433
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840