DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and CG10565

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster


Alignment Length:347 Identity:73/347 - (21%)
Similarity:131/347 - (37%) Gaps:108/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKYSDVNLYDLLGIS---LESDQNEIRKAYRKKALECHPDKNPDNPKAV----ERFHELSKALEI 61
            |::.|.:.|.:||:.   .|:.::::|:|||:..|..||||.....:.|    :.|..::||.||
  Fly    70 KEWKDQDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEI 134

  Fly    62 LTDESARAAYDKV-------LKAK------------KAAELRSR-----------QLDGKRQKLK 96
            |.....|.::|.|       |.::            |...|..|           |:|.||::: 
  Fly   135 LGTSKPRRSFDSVDPEFDDSLPSQNDIDNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDAKREEV- 198

  Fly    97 LELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIERLRREGSRLLEEEQRA-----MQEQFRR- 155
                ||.....:.....:.:|.:.:.|:|...::.||      |.:|:|.||     .:|:..| 
  Fly   199 ----ERFYNFWYDFKSWREFSYLDEEDKEKGQDRDER------RWIEKENRAARIKRKKEEMSRI 253

  Fly   156 ---------NHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQELLKYLKKYGDVVALVVNS 211
                     |....|:.:|:.....:|..|.||        |..|.:                  
  Fly   254 RSLVDLAYNNDKRIQRFKQEEKDRKAAAKRAKM--------DAAQAQ------------------ 292

  Fly   212 KRRGRAMVELATREACDMVLAYEKGDPAKPLHFEWVTPP--------AADKQTTKSATTGCSASS 268
                :|..:.|.|||   .||.||.:.|:....|.:...        ..:::|.:.....|...:
  Fly   293 ----KAEADRAIREA---ALAKEKAEKAEQKRIEQIRIEREQQKKLLKKERKTLRDKVKDCKYYA 350

  Fly   269 TDYEDLVMRKLRQAEERKRLIE 290
            .:.:|    :|:..|..:::.|
  Fly   351 KNDKD----QLKHMEGTEKICE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 21/68 (31%)
RRM_DNAJC17 175..247 CDD:240875 16/71 (23%)
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 49/216 (23%)
DnaJ 76..145 CDD:278647 21/68 (31%)
RILP-like 268..>344 CDD:304877 20/108 (19%)
RAC_head 332..401 CDD:293322 6/41 (15%)
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.