DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and CG7394

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001137933.1 Gene:CG7394 / 39294 FlyBaseID:FBgn0036173 Length:128 Species:Drosophila melanogaster


Alignment Length:71 Identity:18/71 - (25%)
Similarity:34/71 - (47%) Gaps:14/71 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKKY-----------SDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHE 54
            ||:.||           .:.:|  :||:|..:.:.:|:.|::|..|..|||:. .:|....:.:|
  Fly    58 MAASKYYKGGFDPKMNKREASL--ILGVSPSASKIKIKDAHKKIMLLNHPDRG-GSPYLAAKINE 119

  Fly    55 LSKALE 60
            ....|:
  Fly   120 AKDFLD 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 14/51 (27%)
RRM_DNAJC17 175..247 CDD:240875
CG7394NP_001137933.1 DnaJ 15..126 CDD:295354 18/71 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.